Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23) Recombinant Protein | Slc25a23 recombinant protein

Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23)

Gene Names
Slc25a23; SCaMC-3; 2310067G05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23); Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23); Slc25a23 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-467aa; full length protein
Sequence
MRGGSSDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGRGDPDRAQQGVSSDWDAD PDGGLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKI LHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKL TGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSL WRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQERFVAGSLAGATAQTIIYPME VLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKN RWLQQYSHESANPGILVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGGPQVSMVGL LRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc25a23 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,497 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-3
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
NCBI Official Symbol
Slc25a23
NCBI Official Synonym Symbols
SCaMC-3; 2310067G05Rik
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-3
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-3
UniProt Gene Name
Slc25a23
UniProt Synonym Gene Names
Scamc3
UniProt Entry Name
SCMC3_MOUSE

Uniprot Description

SLC25A23: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Belongs to the mitochondrial carrier family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, multi-pass; Mitochondrial; Transporter, SLC family; Membrane protein, integral

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: calcium ion binding; metal ion binding; structural constituent of ribosome

Biological Process: adenine nucleotide transport; regulation of cellular respiration; regulation of oxidative phosphorylation; regulation of sequestering of calcium ion; translation; transmembrane transport; transport

Research Articles on Slc25a23

Similar Products

Product Notes

The Slc25a23 slc25a23 (Catalog #AAA7029892) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-467aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc25a23 slc25a23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRGGSSDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGRGDPDRAQ QGVSSDWDAD PDGGLSLEEF TRYLQEREQR LLLMFHSLDR NQDGHIDVSE IQQSFRALGI SISLEQAEKI LHSMDRDGTM TIDWQEWRDH FLLHSLENVE DVLYFWKHST VLDIGECLTV PDEFSQEEKL TGMWWKQLVA GAVAGAVSRT GTAPLDRLKV FMQVHASKSN RLNILGGLRN MIQEGGVLSL WRGNGINVLK IAPESAIKFM AYEQIKRAIR GQQETLHVQE RFVAGSLAGA TAQTIIYPME VLKTRLTLRR TGQYKGLLDC AKRILEREGP RAFYRGYLPN VLGIIPYAGI DLAVYETLKN RWLQQYSHES ANPGILVLLG CGTISSTCGQ IASYPLALVR TRMQAQASIE GGPQVSMVGL LRHILSQEGV WGLYRGIAPN FMKVIPAVSI SYVVYENMKQ ALGVTSR. It is sometimes possible for the material contained within the vial of "Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.