Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-binding mitochondrial carrier protein Aralar2 (Slc25a13) Recombinant Protein | Slc25a13 recombinant protein

Recombinant Mouse Calcium-binding mitochondrial carrier protein Aralar2 (Slc25a13)

Gene Names
Slc25a13; Ctrn; AI785475
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding mitochondrial carrier protein Aralar2 (Slc25a13); Recombinant Mouse Calcium-binding mitochondrial carrier protein Aralar2 (Slc25a13); Slc25a13 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-676aa; full length protein
Sequence
MAAAKVALTKRADPAELKAIFLKYASIEKNGEFFMSPHDFVTRYLNIFGESQPNPKTVEL LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQIFGQTT IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNAKTGKVSA IDFRDIMVTIRPHVLTPFVEECLVAAAGGTRSHQVSFSYFNGFNSLLNNMELIRKIYSTL AGNRKDVEVTKEEFALAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGM LPFNLAEAQRQQKASGDAARPFLLQLAESAYRFGLGSIAGAVGATAVYPIDLVKTRMQNQ RSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKF MHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGF FGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVT PADVIKTRLQVAARAGQTTYNGVTDCFRKILREEGPKALWKGVAARVFRSSPQFGVTLLT YELLQRWFYVDFGGVKPVGSEPVPKSRITLPAPNPDHVGGYKLAVATFAGIENKFGLYLP LFKPSASTSKVTAGDS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc25a13 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,467 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein Aralar2 isoform 2
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 13
NCBI Official Symbol
Slc25a13
NCBI Official Synonym Symbols
Ctrn; AI785475
NCBI Protein Information
calcium-binding mitochondrial carrier protein Aralar2
UniProt Protein Name
Calcium-binding mitochondrial carrier protein Aralar2
UniProt Gene Name
Slc25a13
UniProt Synonym Gene Names
Aralar2
UniProt Entry Name
CMC2_MOUSE

Uniprot Description

SLC25A13: Catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle. Defects in SLC25A13 are the cause of citrullinemia type 2 (CTLN2). Citrullinemia belongs to the urea cycle disorders. It is an autosomal recessive disease characterized primarily by elevated serum and urine citrulline levels. Ammonia intoxication is another manifestation. CTLN2 is characterized by neuropsychiatric symptoms including abnormal behaviors, loss of memory, seizures and coma. Death can result from brain edema. Onset is sudden and usually between the ages of 20 and 50 years. Defects in SLC25A13 are the cause of neonatal intrahepatic cholestasis due to citrin deficiency (NICCD). NICCD is a form of citrullinemia type 2 with neonatal onset. NICCD is characterized by suppression of the bile flow, hepatic fibrosis, low birth weight, growth retardation, hypoproteinemia, variable liver dysfunction. NICCD is generally not severe and symptoms disappear by one year of age with an appropriate diet. Years or even decades later, however, some individuals develop the characteristic features of citrullinemia type 2 with neuropsychiatric symptoms. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Mitochondrial; Transporter; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: calcium ion binding; L-aspartate transmembrane transporter activity; L-glutamate transmembrane transporter activity; metal ion binding; structural constituent of ribosome

Biological Process: aspartate transport; ATP biosynthetic process; cellular respiration; L-glutamate transport; malate-aspartate shuttle; response to calcium ion; translation; transmembrane transport; transport

Research Articles on Slc25a13

Similar Products

Product Notes

The Slc25a13 slc25a13 (Catalog #AAA7029862) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-676aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc25a13 slc25a13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAAKVALTK RADPAELKAI FLKYASIEKN GEFFMSPHDF VTRYLNIFGE SQPNPKTVEL LSGVVDQTKD GLISFQEFVA FESVLCAPDA LFMVAFQLFD KAGKGEVTFE DVKQIFGQTT IHQHIPFNWD SEFVQLHFGK ERKRHLTYAE FTQFLLEIQL EHAKQAFVQR DNAKTGKVSA IDFRDIMVTI RPHVLTPFVE ECLVAAAGGT RSHQVSFSYF NGFNSLLNNM ELIRKIYSTL AGNRKDVEVT KEEFALAAQK FGQVTPMEVD ILFQLADLYE PRGRMTLADI ERIAPLEEGM LPFNLAEAQR QQKASGDAAR PFLLQLAESA YRFGLGSIAG AVGATAVYPI DLVKTRMQNQ RSTGSFVGEL MYKNSFDCFK KVLRYEGFFG LYRGLLPQLL GVAPEKAIKL TVNDFVRDKF MHKDGSVPLL AEIFAGGCAG GSQVIFTNPL EIVKIRLQVA GEITTGPRVS ALSVVRDLGF FGIYKGAKAC FLRDIPFSAI YFPCYAHVKA SFANEDGQVS PGSLLLAGAI AGMPAASLVT PADVIKTRLQ VAARAGQTTY NGVTDCFRKI LREEGPKALW KGVAARVFRS SPQFGVTLLT YELLQRWFYV DFGGVKPVGS EPVPKSRITL PAPNPDHVGG YKLAVATFAG IENKFGLYLP LFKPSASTSK VTAGDS. It is sometimes possible for the material contained within the vial of "Calcium-binding mitochondrial carrier protein Aralar2 (Slc25a13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.