Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tricarboxylate transport protein, mitochondrial (SLC25A1) Recombinant Protein | SLC25A1 recombinant protein

Recombinant Human Tricarboxylate transport protein, mitochondrial (SLC25A1), partial

Gene Names
SLC25A1; CTP; SEA; D2L2AD; SLC20A3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tricarboxylate transport protein; mitochondrial (SLC25A1); Recombinant Human Tricarboxylate transport protein; partial; SLC25A1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
14-311
Sequence
APASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD
Sequence Length
311
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,013 Da
NCBI Official Full Name
tricarboxylate transport protein, mitochondrial isoform a
NCBI Official Synonym Full Names
solute carrier family 25 member 1
NCBI Official Symbol
SLC25A1
NCBI Official Synonym Symbols
CTP; SEA; D2L2AD; SLC20A3
NCBI Protein Information
tricarboxylate transport protein, mitochondrial
UniProt Protein Name
Tricarboxylate transport protein, mitochondrial
UniProt Gene Name
SLC25A1
UniProt Synonym Gene Names
SLC20A3; CTP

NCBI Description

This gene encodes a member of the mitochondrial carrier subfamily of solute carrier proteins. Members of this family include nuclear-encoded transporters that translocate small metabolites across the mitochondrial membrane. This protein regulates the movement of citrate across the inner membranes of the mitochondria. Mutations in this gene have been associated with combined D-2- and L-2-hydroxyglutaric aciduria. Pseudogenes of this gene have been identified on chromosomes 7, 11, 16, and 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.

Research Articles on SLC25A1

Similar Products

Product Notes

The SLC25A1 slc25a1 (Catalog #AAA954430) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 14-311. The amino acid sequence is listed below: APASGKAKLT HPGKAILAGG LAGGIEICIT FPTEYVKTQL QLDERSHPPR YRGIGDCVRQ TVRSHGVLGL YRGLSSLLYG SIPKAAVRFG MFEFLSNHMR DAQGRLDSTR GLLCGLGAGV AEAVVVVCPM ETIKVKFIHD QTSPNPKYRG FFHGVREIVR EQGLKGTYQG LTATVLKQGS NQAIRFFVMT SLRNWYRGDN PNKPMNPLIT GVFGAIAGAA SVFGNTPLDV IKTRMQGLEA HKYRNTWDCG LQILKKEGLK AFYKGTVPRL GRVCLDVAIV FVIYDEVVKL LNKVWKTD. It is sometimes possible for the material contained within the vial of "Tricarboxylate transport protein, mitochondrial (SLC25A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.