Excitatory amino acid transporter 4 (Slc1a6) Recombinant Protein | Slc1a6 recombinant protein

Recombinant Rat Excitatory amino acid transporter 4 (Slc1a6), partial

Cat. Num. AAA1135972

• Gene Names: Slc1a6; EAAT4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Excitatory amino acid transporter 4 (Slc1a6); Recombinant Rat Excitatory amino acid transporter 4 (Slc1a6); partial; Slc1a6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 151-261
• Sequence: HPGKGSKEGLHREGRIETVPTADAFMDLVRNMFPPNLVEACFKQFKTQYSTRVVTRTIVRTDNGSELGASISPPSSAENETSILENVTRALGTLQEVISFEETVPVPGSAN
• Sequence Length: 561

• Species: Rattus norvegicus (Rat)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 14091748
• NCBI GeneID: 84012
• NCBI Accession #: NP_114454.1
• NCBI GenBank Nucleotide #: NM_032065.1
• UniProt Accession #: O35921; P97683
• Molecular Weight: 60,715 Da
• NCBI Official Full Name: excitatory amino acid transporter 4
• NCBI Official Synonym Full Names: solute carrier family 1 member 6
• NCBI Official Symbol: Slc1a6
• NCBI Official Synonym Symbols: EAAT4
• NCBI Protein Information: excitatory amino acid transporter 4
• UniProt Protein Name: Excitatory amino acid transporter 4
• Protein Family: Excitatory amino acid transporter
• UniProt Gene Name: Slc1a6
• UniProt Synonym Gene Names: Eaat4

NCBI Description

mediates cotransport of one glutamate molecule with three Na+ ions and one H+ with countertransport of one K+ ion; also has a voltage gated anion transporter activity that is modified by glutamate [RGD, Feb 2006]

Uniprot Description

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:14506254, PubMed:26690923). Functions as a symporter that transports one amino acid molecule together with two or three Na+ ions and one proton, in parallel with the counter-transport of one K+ ion (PubMed:14506254). Mediates Cl- flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na+ symport (PubMed:14506254). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (Probable).