Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Cystatin 9 antibody (MBS5301463) used at 1 ug/ml to detect target protein.)

Rabbit Cystatin 9 Polyclonal Antibody | anti-CST9 antibody

Cystatin 9 antibody

Gene Names
CST9; CLM; CTES7A
Applications
Western Blot
Purity
Affinity purified
Synonyms
Cystatin 9; Polyclonal Antibody; Cystatin 9 antibody; Polyclonal Cystatin 9; Anti-Cystatin 9; CLM; Testatin; Cystatin -9; CST9; anti-CST9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CST9 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
159
Applicable Applications for anti-CST9 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions.
Cross-Reactivity
Human
Immunogen
Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Cystatin 9 antibody (MBS5301463) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Cystatin 9 antibody (MBS5301463) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CST9 antibody
Rabbit polyclonal Cystatin 9 antibody
Product Categories/Family for anti-CST9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18 kDa (MW of target protein)
NCBI Official Full Name
cystatin-9
NCBI Official Synonym Full Names
cystatin 9 (testatin)
NCBI Official Symbol
CST9
NCBI Official Synonym Symbols
CLM; CTES7A
NCBI Protein Information
cystatin-9
UniProt Protein Name
Cystatin-9
Protein Family
UniProt Gene Name
CST9
UniProt Synonym Gene Names
CLM
UniProt Entry Name
CST9_HUMAN

NCBI Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. [provided by RefSeq, Jul 2008]

Uniprot Description

CST9: May play a role in hematopoietic differentiation or inflammation. Belongs to the cystatin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: extracellular region

Molecular Function: cysteine protease inhibitor activity

Research Articles on CST9

Similar Products

Product Notes

The CST9 cst9 (Catalog #AAA5301463) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cystatin 9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CST9 cst9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cystatin 9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.