Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Monocarboxylate transporter 8 (SLC16A2) Recombinant Protein | SLC16A2 recombinant protein

Recombinant Human Monocarboxylate transporter 8 (SLC16A2), partial

Gene Names
SLC16A2; AHDS; MCT7; MCT8; XPCT; MCT 7; MCT 8; MRX22; DXS128; DXS128E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monocarboxylate transporter 8 (SLC16A2); Recombinant Human Monocarboxylate transporter 8 (SLC16A2); partial; SLC16A2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-539
Sequence
ALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Sequence Length
539
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,511 Da
NCBI Official Full Name
monocarboxylate transporter 8
NCBI Official Synonym Full Names
solute carrier family 16 member 2
NCBI Official Symbol
SLC16A2
NCBI Official Synonym Symbols
AHDS; MCT7; MCT8; XPCT; MCT 7; MCT 8; MRX22; DXS128; DXS128E
NCBI Protein Information
monocarboxylate transporter 8
UniProt Protein Name
Monocarboxylate transporter 8
UniProt Gene Name
SLC16A2
UniProt Synonym Gene Names
MCT8; XPCT; MCT 8; MCT 7

NCBI Description

This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome. [provided by RefSeq, Mar 2012]

Uniprot Description

Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr.

Research Articles on SLC16A2

Similar Products

Product Notes

The SLC16A2 slc16a2 (Catalog #AAA968546) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-539. The amino acid sequence is listed below: ALQSQASEEA KGPWQEADQE QQEPVGSPEP ESEPEPEPEP EPVPVPPPEP QPEPQPLPDP APLPELEFES ERVHEPEPTP TVETRGTARG FQPPEGGFGW VVVFAATWCN GSIFGIHNSV GILYSMLLEE EKEKNRQVEF QAAWVGALAM GMIFFCSPIV SIFTDRLGCR ITATAGAAVA FIGLHTSSFT SSLSLRYFTY GILFGCGCSF AFQPSLVILG HYFQRRLGLA NGVVSAGSSI FSMSFPFLIR MLGDKIKLAQ TFQVLSTFMF VLMLLSLTYR PLLPSSQDTP SKRGVRTLHQ RFLAQLRKYF NMRVFRQRTY RIWAFGIAAA ALGYFVPYVH LMKYVEEEFS EIKETWVLLV CIGATSGLGR LVSGHISDSI PGLKKIYLQV LSFLLLGLMS MMIPLCRDFG GLIVVCLFLG LCDGFFITIM APIAFELVGP MQASQAIGYL LGMMALPMIA GPPIAGLLRN CFGDYHVAFY FAGVPPIIGA VILFFVPLMH QRMFKKEQRD SSKDKMLAPD PDPNGELLPG SPNPEEPI. It is sometimes possible for the material contained within the vial of "Monocarboxylate transporter 8 (SLC16A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.