Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Urea transporter 1 (Slc14a1) Recombinant Protein | Slc14a1 recombinant protein

Recombinant Rat Urea transporter 1 (Slc14a1), partial

Gene Names
Slc14a1; UT3; UT-B; UTB1; UrT2; HUT11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Urea transporter 1 (Slc14a1); Recombinant Rat Urea transporter 1 (Slc14a1); partial; Slc14a1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-384
Sequence
MEDIPTMVKVDRGESQILSCRGRRCGLKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILAGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSDKGDYFWWLIFPVSAMSMTCPVFSSALSSLFSKWDLPVFTLPFNMALSLYLSATGHYNTFFPSKLFMPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGAIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFKDIYSGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMTHLMAAVHLPACTWSFCLATLLFLLLTTENPNIYRMPLSKVTYSEENRIFYLQNKKRVVDSPL
Sequence Length
384
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,151 Da
NCBI Official Full Name
urea transporter 1
NCBI Official Synonym Full Names
solute carrier family 14 member 1
NCBI Official Symbol
Slc14a1
NCBI Official Synonym Symbols
UT3; UT-B; UTB1; UrT2; HUT11
NCBI Protein Information
urea transporter 1
UniProt Protein Name
Urea transporter 1
Protein Family
UniProt Gene Name
Slc14a1
UniProt Synonym Gene Names
UT11; UT3; UT-B

NCBI Description

transports urea; plays a role in regulating urea accumulation in the kidney inner medulla and in maintaining water and nitrogen balance [RGD, Apr 2007]

Uniprot Description

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.

Research Articles on Slc14a1

Similar Products

Product Notes

The Slc14a1 slc14a1 (Catalog #AAA948268) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-384. The amino acid sequence is listed below: MEDIPTMVKV DRGESQILSC RGRRCGLKVL GYVTGDMKEF ANWLKDKPVV LQFMDWILRG ISQVVFVSNP ISGILILAGL LVQNPWWALC GCVGTVVSTL TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSDKGDYFWW LIFPVSAMSM TCPVFSSALS SLFSKWDLPV FTLPFNMALS LYLSATGHYN TFFPSKLFMP VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGAIF LCAILLSSPL MCLHAAIGSL LGVIAGLSLA APFKDIYSGL WGFNSSLACI AIGGMFMALT WQTHLLALAC ALFTAYFGAC MTHLMAAVHL PACTWSFCLA TLLFLLLTTE NPNIYRMPLS KVTYSEENRI FYLQNKKRVV DSPL. It is sometimes possible for the material contained within the vial of "Urea transporter 1 (Slc14a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.