F-box protein SKP2B (SKP2B) Recombinant Protein | SKP2B recombinant protein

Recombinant Arabidopsis thaliana F-box protein SKP2B (SKP2B)

Cat. Num. AAA1117106

• Gene Names: SKP2B; ARABIDOPSIS HOMOLOG OF HOMOLOG OF HUMAN SKP2 2; ATSKP2;2; F22K20.10; F22K20_10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: F-box protein SKP2B (SKP2B); Recombinant Arabidopsis thaliana F-box protein SKP2B (SKP2B); SKP2B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-360, Full length protein
• Sequence: MVSEGATRKELNLCFENMKMEGVLISEWKDIPVELLMKILNLVDDRTVIIASCICSGWRDAVSLGLTRLSLSWCKKNMNSLVLSLAPKFVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFCRKLKILNLCGCVEAVSDNTLQAIGENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRAVKKGKFDEEGLRSLNISQCTYLTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLQSVHCACILQAHRTHTVYPHPAH
• Sequence Length: 360

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 334183953
• NCBI GeneID: 844036
• NCBI Accession #: NP_001185415.1
• NCBI GenBank Nucleotide #: NM_001198486.2
• UniProt Accession #: O49286; Q680E2; Q8GY48
• Molecular Weight: 39,909 Da
• NCBI Official Full Name: RNI-like superfamily protein
• NCBI Official Symbol: SKP2B
• NCBI Official Synonym Symbols: ARABIDOPSIS HOMOLOG OF HOMOLOG OF HUMAN SKP2 2; ATSKP2;2; F22K20.10; F22K20_10
• NCBI Protein Information: RNI-like superfamily protein
• UniProt Protein Name: F-box protein SKP2B
• Protein Family: F-box protein
• UniProt Gene Name: SKP2B
• UniProt Synonym Gene Names: FBL5; AtFB5; AtSKP2;2

NCBI Description

AtSKP2;2 is a homolog of human SKP2, the human F-box protein that recruits E2F1. Contains an F-box motif at the N-terminal region and a C-terminal Leu-rich repeat domain. Forms part of an E3-ubiquitin-ligase SCF (Skp1, cullin, F-box) complex and recruits phosphorylated AtE2Fc, a transcriptional factor that might play a role in cell division and during the transition from skotomorphogenesis to photomorphogenesis. AtSKP2;1 (At1g21410) and AtSKP2;2 (At1g77000) may be duplicated genes. AtSKP2b may also be involved in the degradation of KRP1/ICK1, a CDK inhibitor.

Uniprot Description

Component of SCF(SKP2B) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of the cyclin-dependent kinase inhibitor KRP1. Does not interact with auxin.