Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5) Recombinant Protein | SIGLEC5 recombinant protein

Recombinant Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Gene Names
SIGLEC5; CD170; OBBP2; CD33L2; OB-BP2; SIGLEC-5
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5); Recombinant Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5); SIGLEC5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-FFL IVKARRKQAA GRPEKMDDED PIMGTITSGS RKKPWPDSPG DQASPPGDAP PLEEQKELHY ASLSFSEMKS REPKDQEAPS TTEYSEIKTS K
Sequence Length
551
Applicable Applications for SIGLEC5 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Homo sapiens (Human)
Expression System
Prokaryotic expression
Residues
Phe458~Lys551 (Accession # O15389) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.2kDa
NCBI Official Full Name
sialic acid-binding Ig-like lectin 5
NCBI Official Synonym Full Names
sialic acid binding Ig-like lectin 5
NCBI Official Symbol
SIGLEC5
NCBI Official Synonym Symbols
CD170; OBBP2; CD33L2; OB-BP2; SIGLEC-5
NCBI Protein Information
sialic acid-binding Ig-like lectin 5; CD33 antigen-like 2; OB-binding protein 2; obesity-binding protein 2; sialic acid-binding immunoglobulin-like lectin 5
UniProt Protein Name
Sialic acid-binding Ig-like lectin 5
UniProt Gene Name
SIGLEC5
UniProt Synonym Gene Names
CD33L2; OBBP2; Siglec-5; OB-BP2
UniProt Entry Name
SIGL5_HUMAN

NCBI Description

This gene encodes a member of the sialic acid-binding immunoglobulin-like lectin (Siglec) family. These cell surface lectins are characterized by structural motifs in the immunoglobulin (Ig)-like domains and sialic acid recognition sites in the first Ig V set domain. The encoded protein is a member of the CD33-related subset of Siglecs and inhibits the activation of several cell types including monocytes, macrophages and neutrophils. Binding of group B Streptococcus (GBS) to the encoded protein plays a role in GBS immune evasion. [provided by RefSeq, Feb 2012]

Uniprot Description

SIGLEC5: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds equally to alpha-2,3-linked and alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: integral to membrane

Molecular Function: carbohydrate binding

Biological Process: cell adhesion

Research Articles on SIGLEC5

Similar Products

Product Notes

The SIGLEC5 siglec5 (Catalog #AAA2009961) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the SIGLEC5 siglec5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-FFL IVKARRKQAA GRPEKMDDED PIMGTITSGS RKKPWPDSPG DQASPPGDAP PLEEQKELHY ASLSFSEMKS REPKDQEAPS TTEYSEIKTS K. It is sometimes possible for the material contained within the vial of "Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.