Serine/threonine-protein kinase sgk-1 (sgk-1) Recombinant Protein | sgk-1 recombinant protein
Recombinant Caenorhabditis briggsae Serine/threonine-protein kinase sgk-1 (sgk-1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase sgk-1 (sgk-1); Recombinant Caenorhabditis briggsae Serine/threonine-protein kinase sgk-1 (sgk-1); sgk-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-464, Full length protein
Sequence
MGSLYYSGSRMVRKDEVSCKLVMGDDKKTVVYAVRIGDGPIMQKVYEEYEKFFLTDVKDMVPEKFTIFPKKKLLQSKKTFFEKRRLWIQDVCQHLVDNQTKSEDVCRFFHIEAPDDDDNTVDLGPSERKTATANDFDFLTTIGKGSFGRVYQVRHKETKKIYAMKVLSKEHIRKKNEVKHVMAERNVLINNFKHPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFTESRSRFYAAEIACALGYLHEKNIIYRDLKPENLLLDDKGYLVLTDFGLCKEDMQGSKTTSTFCGTPEYLAPEIILKKPYDKTVDWWCLGSVLYEMIFGLPPFYSKDHNEMYDKIINQPLRLKHTISVPCTELITGLLQKDRSKRLGHKNDFRDIQDHPFFLPVDWDKLLNRELKAPFIPKVKNAMDISNISKEFVEIQIDPASLAPQQLAVTHRDHDFENFTFVDTNRVLV
Sequence Length
464
Species
Caenorhabditis briggsae
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
54,252 Da
NCBI Official Full Name
Serine/threonine-protein kinase sgk-1
UniProt Protein Name
Serine/threonine-protein kinase sgk-1
Protein Family
UniProt Gene Name
sgk-1
Uniprot Description
Acts downstream of PI3 kinase age-1 and kinase pdk-1 in the daf-2/insulin receptor-like transduction pathway. Essential role in regulating development, stress response, and longevity. Phosphorylates Forkhead-related daf-16 and the longevity-promoting skn-1 transcription factors, which inhibits their entry into the nucleus and antagonizes their function. Acts downstream of rict-1 to regulate fat storage, size, and development. Downstream of age-1 and together with akt-1/2, promotes cell survival during embryonic development. Does not appear to play a role in immune function.
Similar Products
Product Notes
The sgk-1 sgk-1 (Catalog #AAA1240405) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-464, Full length protein. The amino acid sequence is listed below: MGSLYYSGSR MVRKDEVSCK LVMGDDKKTV VYAVRIGDGP IMQKVYEEYE KFFLTDVKDM VPEKFTIFPK KKLLQSKKTF FEKRRLWIQD VCQHLVDNQT KSEDVCRFFH IEAPDDDDNT VDLGPSERKT ATANDFDFLT TIGKGSFGRV YQVRHKETKK IYAMKVLSKE HIRKKNEVKH VMAERNVLIN NFKHPFLVSL HFSFQNKEKL YFVLDHLNGG ELFSHLQREK HFTESRSRFY AAEIACALGY LHEKNIIYRD LKPENLLLDD KGYLVLTDFG LCKEDMQGSK TTSTFCGTPE YLAPEIILKK PYDKTVDWWC LGSVLYEMIF GLPPFYSKDH NEMYDKIINQ PLRLKHTISV PCTELITGLL QKDRSKRLGH KNDFRDIQDH PFFLPVDWDK LLNRELKAPF IPKVKNAMDI SNISKEFVEI QIDPASLAPQ QLAVTHRDHD FENFTFVDTN RVLV. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase sgk-1 (sgk-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
