Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha-sarcoglycan Recombinant Protein | Sgca recombinant protein

Alpha-sarcoglycan

Gene Names
Sgca; Asg; 50DAG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-sarcoglycan; Sgca recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-387aa; full length protein
Sequence
QQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIEVTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Sgca recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Sgca recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,287 Da
NCBI Official Full Name
alpha-sarcoglycan
NCBI Official Synonym Full Names
sarcoglycan, alpha (dystrophin-associated glycoprotein)
NCBI Official Symbol
Sgca
NCBI Official Synonym Symbols
Asg; 50DAG
NCBI Protein Information
alpha-sarcoglycan
UniProt Protein Name
Alpha-sarcoglycan
Protein Family
UniProt Gene Name
Sgca
UniProt Synonym Gene Names
Alpha-SG; 50DAG
UniProt Entry Name
SGCA_MOUSE

NCBI Description

This gene encodes a member of the sarcoglycan alpha/epsilon family of transmembrane proteins. The encoded protein is part of the dystrophin-glycoprotein complex which links the extracellular matrix to the cytoskeleton in muscle fibers. Disruption of this gene results in progressive muscular dystrophy and is associated with the development of embryonal rhabdomysarcoma. [provided by RefSeq, Dec 2012]

Uniprot Description

SGCA: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. Defects in SGCA are the cause of limb-girdle muscular dystrophy type 2D (LGMD2D); also known as Duchenne- like muscular dystrophy autosomal recessive type 2 or severe childhood autosomal recessive muscular dystrophy (SCARMD). LGMD2D is an autosomal recessive degenerative myopathy characterized by progressive muscle wasting from early childhood with loss of independent ambulation by teenage years. Muscle biopsy shows necrosis, decreased immunostaining for alpha sarcoglycan, and adhalin deficiency. The phenotype is less severe than LGMD2C. Belongs to the sarcoglycan alpha/epsilon family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis

Cellular Component: dystroglycan complex; integral to plasma membrane; intercellular junction; lipid raft; sarcoglycan complex; sarcolemma

Biological Process: muscle system process

Research Articles on Sgca

Similar Products

Product Notes

The Sgca sgca (Catalog #AAA7043315) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-387aa; full length protein. The amino acid sequence is listed below: QQTTLHLLVG RVFVHPLEHA TFLRLPEHVA VPPTVRLTYH AHLQGHPDLP RWLHYTQRSP YNPGFLYGSP TPEDRGYQVI EVTAYNRDSF DTTRQRLLLL IGDPEGPRLP YQAEFLVRSH DVEEVLPTTP ANRFLTALGG LWEPGELQLL NITSALDRGG RVPLPIEGRK EGVYIKVGSA TPFSTCLKMV ASPDSYARCA QGQPPLLSCY DTLAPHFRVD WCNVSLVDKS VPEPLDEVPT PGDGILEHDP FFCPPTEATD RDFLTDALVT LLVPLLVALL LTLLLAYIMC FRREGRLKRD MATSDIQMFH HCSIHGNTEE LRQMAASREV PRPLSTLPMF NVRTGERLPP RVDSAQMPLI LDQH. It is sometimes possible for the material contained within the vial of "Alpha-sarcoglycan, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.