Splicing factor 3A subunit 2 (SF3A2) Recombinant Protein | SF3A2 recombinant protein
Recombinant Bovine Splicing factor 3A subunit 2 (SF3A2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Splicing factor 3A subunit 2 (SF3A2); Recombinant Bovine Splicing factor 3A subunit 2 (SF3A2); SF3A2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-477, Full length protein
Sequence
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPSGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPVVHPPAPAVHPQAPGVHPTPAVHPQAPGVHPPAPGVHPPAPGIHPQPPGVHPPPPGVHPPAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
Sequence Length
477
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SF3A2 recombinant protein
This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,612 Da
NCBI Official Full Name
splicing factor 3A subunit 2
NCBI Official Synonym Full Names
splicing factor 3a subunit 2
NCBI Official Symbol
SF3A2
NCBI Protein Information
splicing factor 3A subunit 2
UniProt Protein Name
Splicing factor 3A subunit 2
Protein Family
UniProt Gene Name
SF3A2
Uniprot Description
Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex ().
Similar Products
Product Notes
The SF3A2 sf3a2 (Catalog #AAA1052376) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-477, Full length protein. The amino acid sequence is listed below: MDFQHRPGGK TGSGGVASSS ESNRDRRERL RQLALETIDI NKDPYFMKNH LGSYECKLCL TLHNNEGSYL AHTQGKKHQT NLARRAAKEA KEAPAQPAPE KVKVEVKKFV KIGRPGYKVT KQRDTEMGQQ SLLFQIDYPE IAEGIMPRHR FMSAYEQRIE PPDRRWQYLL MAAEPYETIA FKVPSREIDK AEGKFWTHWN RETKQFFLQF HFKMEKPPAP PSLPAGPPGV KRPPPPLMNG LPPRPPLPES LPPPPPGGLP LPPMPPSGPA PSGPPGPPQL PPPAPGVHPP APVVHPPASG VHPPAPGVHP PAPGVHPPAP VVHPPASGVH PPAPGVHPPA PGVHPPAPGV HPPAPGVHPP PSAGVHPQAP VVHPPAPAVH PQAPGVHPTP AVHPQAPGVH PPAPGVHPPA PGIHPQPPGV HPPPPGVHPP APGVHPQPPG VHPSNPGVHP PTPMPPMLRP PLPSEGPGNI PPPPPTN. It is sometimes possible for the material contained within the vial of "Splicing factor 3A subunit 2 (SF3A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
