Serine protease inhibitor A3K (Serpina3k) Recombinant Protein | Serpina3k recombinant protein
Recombinant Mouse Serine protease inhibitor A3K (Serpina3k)
Gene Names
Serpina3k; RP54; Spi2; MMCM2; Spi-2; MMSpi2; D12Rp54; contrapsin; 1300001I07Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine protease inhibitor A3K (Serpina3k); Recombinant Mouse Serine protease inhibitor A3K (Serpina3k); Serpina3k recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-418, full length protein
Sequence
FPDGTKEMDIVFHEHQDNGTQDDSLTLASVNTDFAFSLYKKLALKNPDTNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETPEADIHQGFGNLLQSLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEAKNLINDYVSNQTQGMIKELISELDERTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMKMKLLTTRHFRDEELSCSVLELKYTGNASALLILPDQGRMQQVEASLQPETLRKWRKTLFPSQIEELNLPKFSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETKKLSVSQVVHKAVLDVAETGTEAAAATGVIGGIRKAILPAVHFNRPFLFVIYHTSAQSILFMAKVNNPK
Sequence Length
397
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,880 Da
NCBI Official Full Name
serine protease inhibitor A3K
NCBI Official Synonym Full Names
serine (or cysteine) peptidase inhibitor, clade A, member 3K
NCBI Official Symbol
Serpina3k
NCBI Official Synonym Symbols
RP54; Spi2; MMCM2; Spi-2; MMSpi2; D12Rp54; contrapsin; 1300001I07Rik
NCBI Protein Information
serine protease inhibitor A3K
UniProt Protein Name
Serine protease inhibitor A3K
Protein Family
UniProt Gene Name
Serpina3k
UniProt Synonym Gene Names
Mcm2; Spi2; Serpin A3K
Uniprot Description
Contrapsin inhibits trypsin-like proteases.
Research Articles on Serpina3k
Similar Products
Product Notes
The Serpina3k serpina3k (Catalog #AAA1126793) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-418, full length protein. The amino acid sequence is listed below: FPDGTKEMDI VFHEHQDNGT QDDSLTLASV NTDFAFSLYK KLALKNPDTN IVFSPLSISA ALALVSLGAK GKTMEEILEG LKFNLTETPE ADIHQGFGNL LQSLSQPEDQ DQINIGNAMF IEKDLQILAE FHEKTRALYQ TEAFTADFQQ PTEAKNLIND YVSNQTQGMI KELISELDER TLMVLVNYIY FKGKWKISFD PQDTFESEFY LDEKRSVKVP MMKMKLLTTR HFRDEELSCS VLELKYTGNA SALLILPDQG RMQQVEASLQ PETLRKWRKT LFPSQIEELN LPKFSIASNY RLEEDVLPEM GIKEVFTEQA DLSGITETKK LSVSQVVHKA VLDVAETGTE AAAATGVIGG IRKAILPAVH FNRPFLFVIY HTSAQSILFM AKVNNPK. It is sometimes possible for the material contained within the vial of "Serine protease inhibitor A3K (Serpina3k), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
