Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ABL2 monoclonal antibody (M10), clone 3E4 Western Blot analysis of ABL2 expression in K-562 (Cat # L009V1).)

Mouse ABL2 Monoclonal Antibody | anti-ABL2 antibody

ABL2 (v-abl Abelson murine Leukemia Viral OncoGene Homolog 2 (arg, Abelson-Related Gene), ABLL, ARG, FLJ22224, FLJ31718, FLJ41441) (Biotin)

Gene Names
ABL2; ARG; ABLL
Applications
Western Blot
Purity
Purified
Synonyms
ABL2; Monoclonal Antibody; ABL2 (v-abl Abelson murine Leukemia Viral OncoGene Homolog 2 (arg; Abelson-Related Gene); ABLL; ARG; FLJ22224; FLJ31718; FLJ41441) (Biotin); v-abl Abelson murine Leukemia Viral OncoGene Homolog 2 (arg; FLJ41441; anti-ABL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
30000
Specificity
Recognizes ABL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1167
Applicable Applications for anti-ABL2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ABL2 (AAH65912, 743aa-842aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Conjugate
Biotin
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ABL2 monoclonal antibody (M10), clone 3E4 Western Blot analysis of ABL2 expression in K-562 (Cat # L009V1).)

Western Blot (WB) (ABL2 monoclonal antibody (M10), clone 3E4 Western Blot analysis of ABL2 expression in K-562 (Cat # L009V1).)

Testing Data

(Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-ABL2 antibody
This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-ABL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
27
NCBI Official Full Name
ABL2 protein
NCBI Official Synonym Full Names
ABL proto-oncogene 2, non-receptor tyrosine kinase
NCBI Official Symbol
ABL2
NCBI Official Synonym Symbols
ARG; ABLL
NCBI Protein Information
tyrosine-protein kinase ABL2

NCBI Description

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]

Research Articles on ABL2

Similar Products

Product Notes

The ABL2 (Catalog #AAA6171521) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ABL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.