Septin-11 (41528) Recombinant Protein | SEPT11 recombinant protein
Recombinant Mouse Septin-11 (41528)
Gene Names
Sept11; AW548875; D5Ertd606e; 6230410I01Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Septin-11 (41528); Recombinant Mouse Septin-11 (41528); SEPT11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-431, full length protein
Sequence
AVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNPWLCTE
Sequence Length
430
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,965 Da
NCBI Official Full Name
septin-11 isoform 3
NCBI Official Synonym Full Names
septin 11
NCBI Official Symbol
Sept11
NCBI Official Synonym Symbols
AW548875; D5Ertd606e; 6230410I01Rik
NCBI Protein Information
septin-11
UniProt Protein Name
Septin-11
UniProt Gene Name
Sept11
UniProt Synonym Gene Names
D5Ertd606e
Uniprot Description
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity ().
Research Articles on SEPT11
Similar Products
Product Notes
The SEPT11 sept11 (Catalog #AAA1290035) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-431, full length protein. The amino acid sequence is listed below: AVAVGRPSNE ELRNLSLSGH VGFDSLPDQL VNKSTSQGFC FNILCVGETG IGKSTLMDTL FNTKFESDPA THNEPGVRLK ARSYELQESN VRLKLTIVDT VGFGDQINKD DSYKPIVEYI DAQFEAYLQE ELKIKRSLFN YHDTRIHACL YFIAPTGHSL KSLDLVTMKK LDSKVNIIPI IAKADTIAKN ELHKFKSKIM SELVSNGVQI YQFPTDEETV AEINATMSVH LPFAVVGSTE EVKIGNKMAK ARQYPWGVVQ VENENHCDFV KLREMLIRVN MEDLREQTHT RHYELYRRCK LEEMGFKDTD PDSKPFSLQE TYEAKRNEFL GELQKKEEEM RQMFVMRVKE KEAELKEAEK ELHEKFDLLK RTHQEEKKKV EDKKKELEEE VSNFQKKKAA AQLLQSQAQQ SGAQQTKKDK DKKNPWLCTE. It is sometimes possible for the material contained within the vial of "Septin-11 (41528), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
