Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PAFAH2 expression in transfected 293T cell line by PAFAH2 polyclonal antibody. Lane 1: PAFAH2 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PAFAH2 Polyclonal Antibody | anti-PAFAH2 antibody

PAFAH2 (Platelet-activating Factor Acetylhydrolase 2, Cytoplasmic, Serine-dependent Phospholipase A2, FLJ26025) (PE)

Gene Names
PAFAH2; HSD-PLA2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAFAH2; Polyclonal Antibody; PAFAH2 (Platelet-activating Factor Acetylhydrolase 2; Cytoplasmic; Serine-dependent Phospholipase A2; FLJ26025) (PE); anti-PAFAH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PAFAH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PAFAH2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PAFAH2, aa1-392 (NP_000428.2).
Immunogen Sequence
MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PAFAH2 expression in transfected 293T cell line by PAFAH2 polyclonal antibody. Lane 1: PAFAH2 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAFAH2 expression in transfected 293T cell line by PAFAH2 polyclonal antibody. Lane 1: PAFAH2 transfected lysate (44kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PAFAH2 antibody
This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme.
Product Categories/Family for anti-PAFAH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,036 Da
NCBI Official Full Name
platelet-activating factor acetylhydrolase 2, cytoplasmic
NCBI Official Synonym Full Names
platelet activating factor acetylhydrolase 2
NCBI Official Symbol
PAFAH2
NCBI Official Synonym Symbols
HSD-PLA2
NCBI Protein Information
platelet-activating factor acetylhydrolase 2, cytoplasmic
UniProt Protein Name
Platelet-activating factor acetylhydrolase 2, cytoplasmic
UniProt Gene Name
PAFAH2
UniProt Synonym Gene Names
SD-PLA2; hSD-PLA2
UniProt Entry Name
PAFA2_HUMAN

Uniprot Description

PAFAH2: Has a marked selectivity for phospholipids with short acyl chains at the sn-2 position. May share a common physiologic function with the plasma-type enzyme. Belongs to the serine esterase family.

Protein type: EC 3.1.1.47; Hydrolase; Lipid Metabolism - ether lipid; Lipid-binding

Chromosomal Location of Human Ortholog: 1p36

Molecular Function: 1-alkyl-2-acetylglycerophosphocholine esterase activity; phospholipid binding

Biological Process: lipid metabolic process

Similar Products

Product Notes

The PAFAH2 pafah2 (Catalog #AAA6388326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAFAH2 (Platelet-activating Factor Acetylhydrolase 2, Cytoplasmic, Serine-dependent Phospholipase A2, FLJ26025) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAFAH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAFAH2 pafah2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAFAH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.