Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E-Selectin Recombinant Protein | SELE recombinant protein

Recombinant Human E-Selectin HEK

Gene Names
SELE; ELAM; ESEL; CD62E; ELAM1; LECAM2
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
E-Selectin; Recombinant Human E-Selectin HEK; SELE Human HEK; E-Selectin Human Recombinant HEK; E-selectin; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD62E antigen; SELE; ELAM1; ELAM; ESEL; CD62E; SELE HEK; SELE recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
SELE was lyophilized from a 0.2 uM filtered solution of PBS and 4% Mannitol, pH 7.5.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Sequence Length
610
Solubility
It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Related Product Information for SELE recombinant protein
Description: SELE Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 543 amino acids (22-556). SELE is fused to an 8 amino acid His-tag at C-terminus and is purified by proprietary chromatographic techniques.

Introduction: E-selectin which is also called Endothelial leukocyte adhesion molecule 1, ELAM1, ELAM belongs to a family of divalent cation-dependent carbohydrate-binding glycoproteins or adhesion molecules. Eselectin is expressed on the surface of endothelial cells and mediates the interaction of leukocytes and platelets with endothelial cells during an inflammatory response. E-selectin is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA.
Product Categories/Family for SELE recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,655 Da
NCBI Official Full Name
E-selectin
NCBI Official Synonym Full Names
selectin E
NCBI Official Symbol
SELE
NCBI Official Synonym Symbols
ELAM; ESEL; CD62E; ELAM1; LECAM2
NCBI Protein Information
E-selectin; CD62 antigen-like family member E; ELAM-1; endothelial adhesion molecule 1; endothelial leukocyte adhesion molecule 1; leukocyte endothelial cell adhesion molecule 2; leukocyte-endothelial cell adhesion molecule 2
UniProt Protein Name
E-selectin
Protein Family
UniProt Gene Name
SELE
UniProt Synonym Gene Names
ELAM1; ELAM-1; LECAM2
UniProt Entry Name
LYAM2_HUMAN

NCBI Description

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

SELE: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis. Belongs to the selectin/LECAM family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22-q25

Cellular Component: cortical cytoskeleton; extracellular space; perinuclear region of cytoplasm; plasma membrane; integral to membrane; coated pit; caveola; lipid raft

Molecular Function: protein binding; phospholipase binding; transmembrane receptor activity; sialic acid binding

Biological Process: positive regulation of leukocyte migration; positive regulation of receptor internalization; actin filament-based process; calcium-mediated signaling; response to lipopolysaccharide; leukocyte migration during inflammatory response; heterophilic cell adhesion; leukocyte adhesion; phospholipase C activation; regulation of inflammatory response; inflammatory response; blood coagulation; leukocyte tethering or rolling; leukocyte migration

Disease: Hypertension, Essential

Research Articles on SELE

Similar Products

Product Notes

The SELE sele (Catalog #AAA145475) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: WSYNTSTEAM TYDEASAYCQ QRYTHLVAIQ NKEEIEYLNS ILSYSPSYYW IGIRKVNNVW VWVGTQKPLT EEAKNWAPGE PNNRQKDEDC VEIYIKREKD VGMWNDERCS KKKLALCYTA ACTNTSCSGH GECVETINNY TCKCDPGFSG LKCEQIVNCT ALESPEHGSL VCSHPLGNFS YNSSCSISCD RGYLPSSMET MQCMSSGEWS APIPACNVVE CDAVTNPANG FVECFQNPGS FPWNTTCTFD CEEGFELMGA QSLQCTSSGN WDNEKPTCKA VTCRAVRQPQ NGSVRCSHSP AGEFTFKSSC NFTCEEGFML QGPAQVECTT QGQWTQQIPV CEAFQCTALS NPERGYMNCL PSASGSFRYG SSCEFSCEQG FVLKGSKRLQ CGPTGEWDNE KPTCEAVRCD AVHQPPKGLV RCAHSPIGEF TYKSSCAFSC EEGFELHGST QLECTSQGQW TEEVPSCQVV KCSSLAVPGK INMSCSGEPV FGTVCKFACP EGWTLNGSAA RTCGATGHWS GLLPTCEAPT ESNIPVD HHHHHH. It is sometimes possible for the material contained within the vial of "E-Selectin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.