Protein translocase subunit SecY (secY) Recombinant Protein | secY recombinant protein
Recombinant Corynebacterium glutamicum Protein translocase subunit SecY (secY), partial
Gene Names
secY; Cgl0555
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein translocase subunit SecY (secY); Recombinant Corynebacterium glutamicum Protein translocase subunit SecY (secY); partial; secY recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-440
Sequence
MSAIIQAFKDADLRKKIFFTIAMIVLYRIGAQIPSPGVDYATISGRLRDLTQDQSSVYSLINLFSGGALLQLSIFAIGIMPYITASIIVQLLTVVIPHFEELKKEGQSGQAKMMQYTRYLTVALALLQSSGIVALADREQLLGAGIRVLSADRNFFDLIVLVITMTAGAVLVMWMGELITEKGVGNGMSLLIFAGIATRLPTDGMNILGNSGGVVFAVVLASVLILVIGVVFVEQGQRRIPVQYAKRMVGRRQYGGSSTYLPLKVNQAGVIPVIFASSLIYMPVLITQIVNSGSLEVSDNWWQRNIIAHLQTPSSWQYIVLYFALTIFFSYFYVSVQYDPAEQAENMKKYGGFIPGIRPGRPTAEYLGFVMNRLLFVGSLYLAVIAVLPNIMLDLGVDAGSAGATPFGGTAILILVSVALTTVKQIESQLLQSNYEGLLK
Sequence Length
440
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,903 Da
NCBI Official Full Name
preprotein translocase subunit SecY
NCBI Official Symbol
secY
NCBI Official Synonym Symbols
Cgl0555
NCBI Protein Information
preprotein translocase subunit SecY
UniProt Protein Name
Protein translocase subunit SecY
Protein Family
UniProt Gene Name
secY
Uniprot Description
The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently.
Similar Products
Product Notes
The secY secy (Catalog #AAA1214574) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-440. The amino acid sequence is listed below: MSAIIQAFKD ADLRKKIFFT IAMIVLYRIG AQIPSPGVDY ATISGRLRDL TQDQSSVYSL INLFSGGALL QLSIFAIGIM PYITASIIVQ LLTVVIPHFE ELKKEGQSGQ AKMMQYTRYL TVALALLQSS GIVALADREQ LLGAGIRVLS ADRNFFDLIV LVITMTAGAV LVMWMGELIT EKGVGNGMSL LIFAGIATRL PTDGMNILGN SGGVVFAVVL ASVLILVIGV VFVEQGQRRI PVQYAKRMVG RRQYGGSSTY LPLKVNQAGV IPVIFASSLI YMPVLITQIV NSGSLEVSDN WWQRNIIAHL QTPSSWQYIV LYFALTIFFS YFYVSVQYDP AEQAENMKKY GGFIPGIRPG RPTAEYLGFV MNRLLFVGSL YLAVIAVLPN IMLDLGVDAG SAGATPFGGT AILILVSVAL TTVKQIESQL LQSNYEGLLK. It is sometimes possible for the material contained within the vial of "Protein translocase subunit SecY (secY), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
