Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CD3D rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.)

Rabbit anti-Human, Mouse CD3D Polyclonal Antibody | anti-CD3D antibody

CD3D (T-cell Surface Glycoprotein CD3 delta Chain, T-cell Receptor T3 delta Chain, CD3d, T3D) (PE)

Gene Names
CD3D; T3D; IMD19; CD3-DELTA
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD3D; Polyclonal Antibody; CD3D (T-cell Surface Glycoprotein CD3 delta Chain; T-cell Receptor T3 delta Chain; CD3d; T3D) (PE); anti-CD3D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD3D. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CD3D antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD3D, aa1-171 (NP_000723.1).
Immunogen Sequence
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CD3D rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.)

Western Blot (WB) (CD3D rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of CD3D expression in transfected 293T cell line by CD3D polyclonal antibody. Lane 1: CD3D transfected lysate (18.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD3D expression in transfected 293T cell line by CD3D polyclonal antibody. Lane 1: CD3D transfected lysate (18.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX. HeLa cells were stained with CD3D rabbit purified polyclonal 1:1200 and CANX mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX. HeLa cells were stained with CD3D rabbit purified polyclonal 1:1200 and CANX mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-CD3D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
915
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,484 Da
NCBI Official Full Name
T-cell surface glycoprotein CD3 delta chain isoform A
NCBI Official Synonym Full Names
CD3d molecule
NCBI Official Symbol
CD3D
NCBI Official Synonym Symbols
T3D; IMD19; CD3-DELTA
NCBI Protein Information
T-cell surface glycoprotein CD3 delta chain

NCBI Description

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009]

Research Articles on CD3D

Similar Products

Product Notes

The CD3D (Catalog #AAA6373069) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD3D (T-cell Surface Glycoprotein CD3 delta Chain, T-cell Receptor T3 delta Chain, CD3d, T3D) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD3D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD3D for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD3D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.