Preprotein translocase subunit SecE (secE) Recombinant Protein | secE recombinant protein
Recombinant Escherichia coli Preprotein translocase subunit SecE (secE)
Gene Names
secE; ECK3972; JW3944; mbrC; prlG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Preprotein translocase subunit SecE (secE); Recombinant Escherichia coli Preprotein translocase subunit SecE (secE); secE recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-127aa; full length protein
Sequence
MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for secE recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,643 Da
NCBI Official Full Name
preprotein translocase membrane subunit
NCBI Official Symbol
secE
NCBI Official Synonym Symbols
ECK3972; JW3944; mbrC; prlG
NCBI Protein Information
preprotein translocase membrane subunit
UniProt Protein Name
Protein translocase subunit SecE
Protein Family
UniProt Gene Name
secE
UniProt Entry Name
SECE_ECOLI
NCBI Description
SecYEG complex interacts with SecDFyajC to form a hexameric holocomplex. mbrC17 is a point mutation 23 nt before secE that increases secE and nusB expression. [More information is available at EcoGene: EG10939]. SecE is an inner membrane protein involved in the Sec secretion pathway. [More information is available at EcoCyc: EG10939].
Uniprot Description
Essential subunit of the protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. Overexpression of some hybrid proteins has been thought to jam the protein secretion apparatus resulting in cell death; while this may be true it also results in FtsH-mediated degradation of SecY.
Research Articles on secE
Similar Products
Product Notes
The secE sece (Catalog #AAA7029486) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-127aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the secE sece for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSANTEAQGS GRGLEAMKWV VVVALLLVAI VGNYLYRDIM LPLRALAVVI LIAAAGGVAL LTTKGKATVA FAREARTEVR KVIWPTRQET LHTTLIVAAV TAVMSLILWG LDGILVRLVS FITGLRF. It is sometimes possible for the material contained within the vial of "Preprotein translocase subunit SecE (secE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
