Signal peptidase complex catalytic subunit SEC11A (SEC11A) Recombinant Protein | SEC11A recombinant protein
Recombinant Dog Signal peptidase complex catalytic subunit SEC11A (SEC11A)
Gene Names
SEC11A; SPC18; SEC11L1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal peptidase complex catalytic subunit SEC11A (SEC11A); Recombinant Dog Signal peptidase complex catalytic subunit SEC11A (SEC11A); Recombinant Signal peptidase complex catalytic subunit SEC11A (SEC11A); Signal peptidase complex catalytic subunit SEC11A EC= 3.4.21.89; Endopeptidase SP18 Microsomal signal peptidase 18 kDa subunit; SPase 18 kDa subunit SEC11 homolog A SEC11-like protein; SEC11A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-179
Sequence
MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
Sequence Length
179
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,625 Da
NCBI Official Full Name
signal peptidase complex catalytic subunit SEC11A
NCBI Official Symbol
SEC11A
NCBI Official Synonym Symbols
SPC18; SEC11L1
NCBI Protein Information
signal peptidase complex catalytic subunit SEC11A; SEC11-like 1; endopeptidase SP18; SEC11-like protein 1; SPase 18 kDa subunit; signal peptidase complex (18kD); microsomal signal peptidase complex; microsomal signal peptidase 18 kDa subunit
UniProt Protein Name
Signal peptidase complex catalytic subunit SEC11A
Protein Family
UniProt Gene Name
SEC11A
UniProt Synonym Gene Names
SEC11L1; SPC18; SPase 18 kDa subunit
UniProt Entry Name
SC11A_CANFA
Uniprot Description
SEC11A: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Belongs to the peptidase S26B family.
Protein type: Protease; EC 3.4.21.89; Membrane protein, integral
Chromosomal Location of Human Ortholog: 15q25.3
Cellular Component: endoplasmic reticulum membrane; integral to membrane
Molecular Function: serine-type peptidase activity
Biological Process: SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; signal peptide processing; gene expression; proteolysis; regulation of insulin secretion
Similar Products
Product Notes
The SEC11A sec11a (Catalog #AAA958033) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-179. The amino acid sequence is listed below: MLSLDFLDDV RRMNKRQLYY QVLNFGMIVS SALMIWKGLM VITGSESPIV VVLSGSMEPA FHRGDLLFLT NRVEDPIRVG EIVVFRIEGR EIPIVHRVLK IHEKQNGHIK FLTKGDNNAV DDRGLYKQGQ HWLEKKDVVG RARGFVPYIG IVTILMNDYP KFKYAVLFLL GLFVLVHRE. It is sometimes possible for the material contained within the vial of "Signal peptidase complex catalytic subunit SEC11A (SEC11A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
