Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Signal peptidase complex catalytic subunit SEC11 (SEC11) Recombinant Protein | KLTH0C00946g recombinant protein

Recombinant Lachancea thermotolerans Signal peptidase complex catalytic subunit SEC11 (SEC11)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal peptidase complex catalytic subunit SEC11 (SEC11); Recombinant Lachancea thermotolerans Signal peptidase complex catalytic subunit SEC11 (SEC11); Recombinant Signal peptidase complex catalytic subunit SEC11 (SEC11); Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89; Signal peptidase I; KLTH0C00946g recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-168
Sequence
MNLRLELTRFLNLCFALASAFMFWKGLSIVTNSHSPIVVVLSGSMEPAFQRGDILFLWNRNELNKVGDVVVYEVDNKEIPIVHRVLREHVDETSGKQLLLTKGDNNAGNDIPLYAKRKIYLHKEKDIVGTVKGYIPQLGYITIWISENKYAKMGLMGLIALSALLSNE
Sequence Length
168
Species
Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,977 Da
NCBI Official Full Name
KLTH0C00946p
NCBI Official Symbol
KLTH0C00946g
NCBI Protein Information
KLTH0C00946p
UniProt Protein Name
Signal peptidase complex catalytic subunit SEC11
UniProt Gene Name
SEC11
UniProt Entry Name
SEC11_LACTC

Uniprot Description

Function: Catalytic component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum

By similarity.

Catalytic activity: Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.

Subunit structure: Component of the signal peptidase complex (SPC)

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Single-pass type II membrane protein

By similarity.

Sequence similarities: Belongs to the peptidase S26B family.

Similar Products

Product Notes

The KLTH0C00946g sec11 (Catalog #AAA1073020) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-168. The amino acid sequence is listed below: MNLRLELTRF LNLCFALASA FMFWKGLSIV TNSHSPIVVV LSGSMEPAFQ RGDILFLWNR NELNKVGDVV VYEVDNKEIP IVHRVLREHV DETSGKQLLL TKGDNNAGND IPLYAKRKIY LHKEKDIVGT VKGYIPQLGY ITIWISENKY AKMGLMGLIA LSALLSNE. It is sometimes possible for the material contained within the vial of "Signal peptidase complex catalytic subunit SEC11 (SEC11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.