Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD) Recombinant Protein | SDHD recombinant protein

Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

• Gene Names: SDHD; CybS; QPs3; CII-4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit; mitochondrial (SDHD); Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit; Recombinant Succinate dehydrogenase [ubiquinone] cytochrome b small subunit; mitochondrial; CybS; CII-4 QPs3 Succinate dehydrogenase complex subunit D Succinate-ubiquin; SDHD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 37-159
• Sequence: DRHTPGWCGVQHIHLSPSHQASSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL
• Sequence Length: 159

• Species: Sus scrofa (Pig)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 148231660
• NCBI GeneID: 100048954
• NCBI Accession #: NP_001090985.1
• NCBI GenBank Nucleotide #: NM_001097516.1
• UniProt Accession #: A5GZW8; A7E1T4; A7E1T8
• Molecular Weight: 17,005 Da
• NCBI Official Full Name: succinate dehydrogenase
• NCBI Official Symbol: SDHD
• NCBI Official Synonym Symbols: CybS; QPs3; CII-4
• NCBI Protein Information: succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone reductase membrane anchor subunit; Succinate-ubiquinone oxidoreductase cytochrome b small subunit
• UniProt Protein Name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
• Protein Family: Succinate dehydrogenase
• UniProt Gene Name: SDHD
• UniProt Synonym Gene Names: CybS
• UniProt Entry Name: DHSD_PIG

Uniprot Description

SDHD: Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHD are a cause of paragangliomas type 1 (PGL1). A neural crest tumor usually derived from the chromoreceptor tissue of a paraganglion. PGL1 is a rare autosomal dominant disorder which is characterized by the development of mostly benign, highly vascular, slowly growing tumors in the head and neck. In the head and neck region, the carotid body is the largest of all paraganglia and is also the most common site of the tumors. Defects in SDHD are a cause of susceptibility to pheochromocytoma (PCC). A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent. Defects in SDHD may be a cause of susceptibility to intestinal carcinoid tumor (ICT). A yellow, well- differentiated, circumscribed tumor that arises from enterochromaffin cells in the small intestine or, less frequently, in other parts of the gastrointestinal tract. Defects in SDHD are a cause of paraganglioma and gastric stromal sarcoma (PGGSS); also called Carney-Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance. Defects in SDHD are a cause of Cowden-like syndrome (CWDLS). Cowden-like syndrome is a cancer predisposition syndrome associated with elevated risk for tumors of the breast, thyroid, kidney and uterus. Belongs to the CybS family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Carbohydrate Metabolism - citrate (TCA) cycle; Energy Metabolism - oxidative phosphorylation; Mitochondrial

Cellular Component: mitochondrial respiratory chain complex II; mitochondrial inner membrane; integral to membrane

Molecular Function: ubiquinone binding; protein binding; metal ion binding; heme binding

Biological Process: tricarboxylic acid cycle