Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Succinate dehydrogenase cytochrome b560 subunit (SDHC) Recombinant Protein | SDHC recombinant protein

Recombinant Human Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC)

Gene Names
SDHC; CYBL; PGL3; QPS1; SDH3; CYB560
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Succinate dehydrogenase cytochrome b560 subunit (SDHC); Recombinant Human Succinate dehydrogenase cytochrome b560 subunit; mitochondrial (SDHC); SDHC recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
30-169aa; full length protein
Sequence
LGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSA LLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLY QSGVVVLVLTVLSSMGLAAM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SDHC recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,474 Da
NCBI Official Full Name
succinate dehydrogenase cytochrome b560 subunit, mitochondrial isoform 2
NCBI Official Synonym Full Names
succinate dehydrogenase complex subunit C
NCBI Official Symbol
SDHC
NCBI Official Synonym Symbols
CYBL; PGL3; QPS1; SDH3; CYB560
NCBI Protein Information
succinate dehydrogenase cytochrome b560 subunit, mitochondrial
UniProt Protein Name
Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
UniProt Gene Name
SDHC
UniProt Synonym Gene Names
CYB560; SDH3; QPs1; CYBL
UniProt Entry Name
C560_HUMAN

NCBI Description

This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described. [provided by RefSeq, May 2013]

Uniprot Description

SDHC: Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHC are the cause of paragangliomas type 3 (PGL3). A neural crest tumor usually derived from the chromoreceptor tissue of a paraganglion. Paragangliomas are most commonly located in the head and neck region, specifically at the carotid bifurcation, the jugular foramen, the vagal nerve, and in the middle ear. Defects in SDHC are a cause of paraganglioma and gastric stromal sarcoma (PGGSS); also known as Carney- Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance. Belongs to the cytochrome b560 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Mitochondrial; Carbohydrate Metabolism - citrate (TCA) cycle; Membrane protein, multi-pass; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: integral to membrane; mitochondrial inner membrane; mitochondrial respiratory chain complex II; mitochondrion

Molecular Function: electron carrier activity; heme binding; metal ion binding; succinate dehydrogenase activity

Biological Process: aerobic respiration; mitochondrial electron transport, succinate to ubiquinone; tricarboxylic acid cycle

Disease: Gastrointestinal Stromal Tumor; Paraganglioma And Gastric Stromal Sarcoma; Paragangliomas 3

Research Articles on SDHC

Similar Products

Product Notes

The SDHC sdhc (Catalog #AAA7029348) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-169aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SDHC sdhc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGTTAKEEME RFWNKNIGSN RPLSPHITIY SWSLPMAMSI CHRGTGIALS AGVSLFGMSA LLLPGNFESY LELVKSLCLG PALIHTAKFA LVFPLMYHTW NGIRHLMWDL GKGLKIPQLY QSGVVVLVLT VLSSMGLAAM. It is sometimes possible for the material contained within the vial of "Succinate dehydrogenase cytochrome b560 subunit (SDHC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.