SDS-PAGE
Stromal cell-derived factor 2 (Sdf2) Recombinant Protein | Sdf2 recombinant protein
Recombinant Mouse Stromal cell-derived factor 2 (Sdf2)
Gene Names
Sdf2; AI853825
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Stromal cell-derived factor 2 (Sdf2); Recombinant Mouse Stromal cell-derived factor 2 (Sdf2); Stromal cell-derived factor 2; SDF-2; Sdf2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-211aa; Full Length of Mature Protein
Sequence
SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL
Sequence Length
211
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Product Categories/Family for Sdf2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.4 kDa
NCBI Official Full Name
stromal cell-derived factor 2
NCBI Official Synonym Full Names
stromal cell derived factor 2
NCBI Official Symbol
Sdf2
NCBI Official Synonym Symbols
AI853825
NCBI Protein Information
stromal cell-derived factor 2; SDF-2
UniProt Protein Name
Stromal cell-derived factor 2
Protein Family
UniProt Gene Name
Sdf2
UniProt Synonym Gene Names
SDF-2
UniProt Entry Name
SDF2_MOUSE
Uniprot Description
SDF2:
Protein type: Secreted; Secreted, signal peptide
Cellular Component: membrane; extracellular region
Similar Products
Product Notes
The Sdf2 sdf2 (Catalog #AAA1282484) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-211aa; Full Length of Mature Protein. The amino acid sequence is listed below: SNMAVVTCGS VVKLLNTRHN VRLHSHDVRY GSGSGQQSVT GVTSVDDSNS YWRIRGKTAT VCERGTPIKC GQPIRLTHIN TGRNLHSHHF TSPLSGNQEV SAFGEEGEGD YLDDWTVLCN GPYWVRDGEV RFKHSSTDVL LSVTGEQYGR PISGQKEVHG MAQPSQNNYW KAMEGIFMKP SELLRAEVHH AEL. It is sometimes possible for the material contained within the vial of "Stromal cell-derived factor 2 (Sdf2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
