Syndecan-4 Recombinant Protein | SDC4 recombinant protein

Recombinant Human Syndecan-4

Cat. Num. AAA1087645

• Gene Names: SDC4; SYND4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Syndecan-4; Recombinant Human Syndecan-4; Amphiglycan; Ryudocan core protein; SDC4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-145aa; Extracellular Domain
• Sequence: ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
• Sequence Length: 198

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SDC4 recombinant protein

Cell surface proteoglycan that bears heparan sulfate.

Product Categories/Family for SDC4 recombinant protein

Neuroscience

References

"Molecular cloning of amphiglycan, a novel integral membrane heparan sulfate proteoglycan expressed by epithelial and fibroblastic cells." David G., van der Schueren B., Marynen P., Cassiman J.-J., van den Berghe H. J. Cell Biol. 118:961-969(1992)

NCBI and Uniprot Product Information

• NCBI GI #: 38201675
• NCBI GeneID: 6385
• NCBI Accession #: NP_002990.2
• NCBI GenBank Nucleotide #: NM_002999.3
• UniProt Accession #: P31431; O00773; Q16833; Q53FN9; Q6FGN3
• Molecular Weight: 29.9 kDa
• NCBI Official Full Name: syndecan-4
• NCBI Official Synonym Full Names: syndecan 4
• NCBI Official Symbol: SDC4
• NCBI Official Synonym Symbols: SYND4
• NCBI Protein Information: syndecan-4
• UniProt Protein Name: Syndecan-4
• Protein Family: Syndecan
• UniProt Gene Name: SDC4
• UniProt Synonym Gene Names: SYND4
• UniProt Entry Name: SDC4_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22. [provided by RefSeq, Jul 2008]

Uniprot Description

syndecan-4: a heparan sulfate proteoglycan type I membrane protein that belongs to the syndecan proteoglycan family. Expressed as a homodimer. Promotes cell spreading in a beta(1) integrin-dependent fashion through PKC-alpha and Rho.

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q12

Cellular Component: cell surface; costamere; focal adhesion; Golgi lumen; integral to plasma membrane; lipid raft; lysosomal lumen; plasma membrane

Molecular Function: fibronectin binding; protein binding; protein kinase C binding

Biological Process: carbohydrate metabolic process; cell migration; chondroitin sulfate metabolic process; extracellular matrix organization and biogenesis; fat-soluble vitamin metabolic process; glycosaminoglycan biosynthetic process; glycosaminoglycan catabolic process; glycosaminoglycan metabolic process; inner ear receptor stereocilium organization and biogenesis; neural tube closure; phototransduction, visible light; positive regulation of focal adhesion formation; positive regulation of protein kinase activity; positive regulation of stress fiber formation; retinoid metabolic process; ureteric bud development; vitamin metabolic process; wound healing