Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sodium channel subunit beta-2 Recombinant Protein | Scn2b recombinant protein

Sodium channel subunit beta-2

Gene Names
Scn2b; SCNB2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sodium channel subunit beta-2; Scn2b recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
30-215aa; full length protein
Sequence
MEVTVPTTLSVLNGSDTRLPCTFNSCYTVNHKQFSLNWTYQECSNCSEEMFLQFRMKIINLKLERFGDRVEFSGNPSKYDVSVTLKNVQLEDEGIYNCYITNPPDRHRGHGKIYLQVLLEVPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNAEDGAK
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Scn2b recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Scn2b recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,145 Da
NCBI Official Full Name
sodium channel subunit beta-2
NCBI Official Synonym Full Names
sodium voltage-gated channel beta subunit 2
NCBI Official Symbol
Scn2b
NCBI Official Synonym Symbols
SCNB2
NCBI Protein Information
sodium channel subunit beta-2
UniProt Protein Name
Sodium channel subunit beta-2
Protein Family
UniProt Gene Name
Scn2b
UniProt Entry Name
SCN2B_RAT

NCBI Description

forms a voltage gated sodium channel with alpha subunit; may modulate sodium channel expression in neurons [RGD, Feb 2006]

Uniprot Description

SCN2B: Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier. Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.

Protein type: Membrane protein, integral

Cellular Component: voltage-gated sodium channel complex

Molecular Function: protein binding; sodium channel regulator activity; voltage-gated sodium channel activity

Biological Process: cardiac muscle contraction; nervous system development; response to pyrethroid

Research Articles on Scn2b

Similar Products

Product Notes

The Scn2b scn2b (Catalog #AAA7043272) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-215aa; full length protein. The amino acid sequence is listed below: MEVTVPTTLS VLNGSDTRLP CTFNSCYTVN HKQFSLNWTY QECSNCSEEM FLQFRMKIIN LKLERFGDRV EFSGNPSKYD VSVTLKNVQL EDEGIYNCYI TNPPDRHRGH GKIYLQVLLE VPPERDSTVA VIVGASVGGF LAVVILVLMV VKCVRRKKEQ KLSTDDLKTE EEGKTDGEGN AEDGAK. It is sometimes possible for the material contained within the vial of "Sodium channel subunit beta-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.