Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HLX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)

Rabbit HLX Polyclonal Antibody | anti-HLX antibody

HLX antibody - middle region

Gene Names
HLX; HB24; HLX1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HLX; Polyclonal Antibody; HLX antibody - middle region; anti-HLX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG
Sequence Length
488
Applicable Applications for anti-HLX antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HLX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HLX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-HLX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)
Related Product Information for anti-HLX antibody
This is a rabbit polyclonal antibody against HLX. It was validated on Western Blot

Target Description: HLX is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
H2.0-like homeobox protein
NCBI Official Synonym Full Names
H2.0 like homeobox
NCBI Official Symbol
HLX
NCBI Official Synonym Symbols
HB24; HLX1
NCBI Protein Information
H2.0-like homeobox protein
UniProt Protein Name
H2.0-like homeobox protein
UniProt Gene Name
HLX
UniProt Synonym Gene Names
HLX1
UniProt Entry Name
HLX_HUMAN

Uniprot Description

HLX: Transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis. Belongs to the H2.0 homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: negative regulation of T-helper 2 cell differentiation; skeletal muscle development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; embryonic digestive tract morphogenesis; multicellular organismal development; positive regulation of cell proliferation; positive regulation of T-helper 1 cell differentiation; liver development; cell differentiation; enteric nervous system development; positive regulation of organ growth

Research Articles on HLX

Similar Products

Product Notes

The HLX hlx (Catalog #AAA3213697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLX antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HLX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HLX hlx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WFQNRRMKWR HSKEAQAQKD KDKEAGEKPS GGAPAADGEQ DERSPSRSEG. It is sometimes possible for the material contained within the vial of "HLX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.