Type-2 restriction enzyme ScaI (scaIR) Recombinant Protein | scaIR recombinant protein
Recombinant Streptomyces caespitosus Type-2 restriction enzyme ScaI (scaIR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Type-2 restriction enzyme ScaI (scaIR); Recombinant Streptomyces caespitosus Type-2 restriction enzyme ScaI (scaIR); scaIR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-227, Full length protein
Sequence
MINDQLPRWVREARVGTRTGGPAMRPKTSDSPYFGWDSEDWPEVTRQLLSEQPLSGDTLVDAVLASWESIFESRLGSGFHIGTQIRPTPQVMGFLLHALIPLELANGDPSWRADLNSSEKDLVYQPDHKYSIEMKTSSHKDQIFGNRSFGVENPGKGKKAKDGYYVAVNFEKWSDAPGRLPRIRTIRYGWLDHTDWVAQKSQTGQQSSLPAVVSNTQLLAIHTGGQR
Sequence Length
227
Species
Streptomyces caespitosus
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
25,464 Da
NCBI Official Full Name
Type-2 restriction enzyme ScaI
UniProt Protein Name
Type-2 restriction enzyme ScaI
Protein Family
UniProt Gene Name
scaIR
UniProt Synonym Gene Names
R.ScaI
Uniprot Description
Recognizes the double-stranded sequence AGTACT and cleaves after T-3.
Similar Products
Product Notes
The scaIR scair (Catalog #AAA1016153) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227, Full length protein. The amino acid sequence is listed below: MINDQLPRWV REARVGTRTG GPAMRPKTSD SPYFGWDSED WPEVTRQLLS EQPLSGDTLV DAVLASWESI FESRLGSGFH IGTQIRPTPQ VMGFLLHALI PLELANGDPS WRADLNSSEK DLVYQPDHKY SIEMKTSSHK DQIFGNRSFG VENPGKGKKA KDGYYVAVNF EKWSDAPGRL PRIRTIRYGW LDHTDWVAQK SQTGQQSSLP AVVSNTQLLA IHTGGQR. It is sometimes possible for the material contained within the vial of "Type-2 restriction enzyme ScaI (scaIR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
