Ribosome maturation protein SBDS (Sbds) Recombinant Protein | Sbds recombinant protein

Recombinant Mouse Ribosome maturation protein SBDS (Sbds)

Cat. Num. AAA959532

• Gene Names: Sbds; SDS; CGI-97; AI836084; 4733401P19Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ribosome maturation protein SBDS (Sbds); Recombinant Mouse Ribosome maturation protein SBDS (Sbds); Sbds recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-250, Full length protein
• Sequence: SIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE
• Sequence Length: 249

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Sbds recombinant protein

This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located.

NCBI and Uniprot Product Information

• NCBI GI #: 23956138
• NCBI GeneID: 66711
• NCBI Accession #: NP_075737.1
• NCBI GenBank Nucleotide #: NM_023248.2
• UniProt Accession #: P70122; Q3TG78; Q9CR18
• Molecular Weight: 28,781 Da
• NCBI Official Full Name: ribosome maturation protein SBDS
• NCBI Official Synonym Full Names: SBDS ribosome maturation factor
• NCBI Official Symbol: Sbds
• NCBI Official Synonym Symbols: SDS; CGI-97; AI836084; 4733401P19Rik
• NCBI Protein Information: ribosome maturation protein SBDS
• UniProt Protein Name: Ribosome maturation protein SBDS
• Protein Family: Ribosome maturation protein
• UniProt Gene Name: Sbds

NCBI Description

This gene encodes a protein that is necessary for ribosome function and maintaining normal levels of protein synthesis. The encoded protein may function to activate ribosomes for translation, and may be involved in cellular response to stress and DNA damage. Loss of this gene is embryonic lethal while deficiency of the encoded protein in the pancreas is associated with symptoms of Shwachman-Diamond syndrome. [provided by RefSeq, Dec 2015]

Uniprot Description

Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFL1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation ().