Serine--tRNA ligase, cytoplasmic (SARS) Recombinant Protein | SARS recombinant protein
Recombinant Rabbit Serine--tRNA ligase, cytoplasmic (SARS)
Gene Names
SARS; SERS; SerRS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine--tRNA ligase; cytoplasmic (SARS); Recombinant Rabbit Serine--tRNA ligase; SARS recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-39, Full length protein
Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKAD
Sequence Length
39
Species
Rabbit
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SARS recombinant protein
This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58,891 Da
NCBI Official Full Name
serine--tRNA ligase, cytoplasmic isoform X2
NCBI Official Symbol
SARS
NCBI Official Synonym Symbols
SERS; SerRS
NCBI Protein Information
serine--tRNA ligase, cytoplasmic
UniProt Protein Name
Serine--tRNA ligase, cytoplasmic
Protein Family
UniProt Gene Name
SARS
UniProt Synonym Gene Names
SERS; SerRS
Uniprot Description
Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction: serine is first activated by ATP to form Ser-AMP and then transferred to the acceptor end of tRNA(Ser). Is probably also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). In the nucleus, binds to the VEGFA core promoter and prevents MYC binding and transcriptional activation by MYC. Recruits SIRT2 to the VEGFA promoter, promoting deacetylation of histone H4 at 'Lys-16' (H4K16). Thereby, inhibits the production of VEGFA and sprouting angiogenesis mediated by VEGFA.
Similar Products
Product Notes
The SARS sars (Catalog #AAA958363) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-39, Full length protein. The amino acid sequence is listed below: VLDLDLFRVD KGGDPALIRE TQEKRFKDPG LVDQLVKAD. It is sometimes possible for the material contained within the vial of "Serine--tRNA ligase, cytoplasmic (SARS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
