Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SARS expression in transfected 293T cell line by SARS polyclonal antibody. Lane 1: SARS transfected lysate (58.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SARS Polyclonal Antibody | anti-SARS antibody

SARS (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS, FLJ36399) (AP)

Gene Names
SARS; SERS; SERRS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SARS; Polyclonal Antibody; SARS (Seryl-tRNA Synthetase; Cytoplasmic; Seryl-tRNA(Ser/Sec) Synthetase; Serine-tRNA Ligase; SerRS; SERS; FLJ36399) (AP); anti-SARS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SARS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SARS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SARS, aa1-514 (NP_006504.2).
Immunogen Sequence
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SARS expression in transfected 293T cell line by SARS polyclonal antibody. Lane 1: SARS transfected lysate (58.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SARS expression in transfected 293T cell line by SARS polyclonal antibody. Lane 1: SARS transfected lysate (58.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SARS antibody
Seryl-tRNA synthetase belongs to the class II amino-acyl tRNA family. This enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
Product Categories/Family for anti-SARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,777 Da
NCBI Official Full Name
serine--tRNA ligase, cytoplasmic
NCBI Official Synonym Full Names
seryl-tRNA synthetase
NCBI Official Symbol
SARS
NCBI Official Synonym Symbols
SERS; SERRS
NCBI Protein Information
serine--tRNA ligase, cytoplasmic; Seryl-tRNA Ser/Sec synthetase; serine tRNA ligase 1, cytoplasmic; seryl-tRNA synthetase, cytoplasmic; seryl-tRNA(Ser/Sec) synthetase
UniProt Protein Name
Serine--tRNA ligase, cytoplasmic
Protein Family
UniProt Gene Name
SARS
UniProt Synonym Gene Names
SERS; SerRS
UniProt Entry Name
SYSC_HUMAN

NCBI Description

This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts. Multiple alternatively spliced transcript variants have been described but the biological validity of all variants is unknown. [provided by RefSeq, Jul 2010]

Uniprot Description

SARS: Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). Belongs to the class-II aminoacyl-tRNA synthetase family. Type-1 seryl-tRNA synthetase subfamily.

Protein type: RNA processing; Translation; Ligase; EC 6.1.1.11

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: RNA binding; serine-tRNA ligase activity; ATP binding

Biological Process: seryl-tRNA aminoacylation; tRNA aminoacylation for protein translation; translation; tRNA processing; gene expression

Research Articles on SARS

Similar Products

Product Notes

The SARS sars (Catalog #AAA6393277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SARS (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS, FLJ36399) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SARS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SARS sars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SARS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.