Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

S-Arrestin (Sag) Recombinant Protein | Sag recombinant protein

Recombinant Mouse S-Arrestin (Sag)

Gene Names
Sag; Arr1; Irbp; arrestin; A930001K18Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
S-Arrestin (Sag); Recombinant Mouse S-Arrestin (Sag); 48 kDa protein; Retinal S-antigen; S-AG; Rod photoreceptor arrestin; Sag recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Detected in retina (at protein level).
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-403aa; Full Length
Sequence
MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE
Sequence Length
403
Species
Mouse
Tag
N-terminal 6xHis-tagged
Subcellular Location
Cell Projection, Cilium, Photoreceptor Outer Segment, Membrane, Peripheral Membrane Protein
Protein Families
Arrestin family
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Sag recombinant protein
Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells.
Product Categories/Family for Sag recombinant protein
References
"Deactivation of phosphorylated and nonphosphorylated rhodopsin by arrestin splice variants." Burns M.E., Mendez A., Chen C.K., Almuete A., Quillinan N., Simon M.I., Baylor D.A., Chen J. J. Neurosci. 26:1036-1044(2006).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.4 kDa
NCBI Official Full Name
S-arrestin
NCBI Official Synonym Full Names
S-antigen, retina and pineal gland (arrestin)
NCBI Official Symbol
Sag
NCBI Official Synonym Symbols
Arr1; Irbp; arrestin; A930001K18Rik
NCBI Protein Information
S-arrestin
UniProt Protein Name
S-arrestin
Protein Family
UniProt Gene Name
Sag
UniProt Synonym Gene Names
S-AG
UniProt Entry Name
ARRS_MOUSE

Uniprot Description

SAG: Arrestin is one of the major proteins of the ros (retinal rod outer segments); it binds to photoactivated- phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase. Retina and pineal gland. Belongs to the arrestin family.

Protein type: G protein regulator, misc.; Motility/polarity/chemotaxis

Cellular Component: photoreceptor inner segment; photoreceptor outer segment

Molecular Function: opsin binding; phosphoprotein binding; spectrin binding

Biological Process: response to stimulus; signal transduction; visual perception

Research Articles on Sag

Similar Products

Product Notes

The Sag sag (Catalog #AAA7115256) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-403aa; Full Length. The amino acid sequence is listed below: MAACGKTNKS HVIFKKVSRD KSVTIYLGKR DYVDHVSQVE PVDGVVLVDP ELVKGKKVYV TLTCAFRYGQ EDIDVMGLTF RRDLYFSRVQ VYPPVGAMSV LTQLQESLLK KLGDNTYPFL LTFPDYLPCS VMLQPAPQDV GKSCGVDFEV KAFASDITDP EEDKIPKKSS VRLLIRKVQH APPEMGPQPS AEASWQFFMS DKPLNLSVSL SKEIYFHGEP IPVTVTVTNN TDKVVKKIKV SVEQIANVVL YSSDYYVKPV ASEETQEKVQ PNSTLTKTLV LVPLLANNRE RRGIALDGKI KHEDTNLASS TIIKEGIDRT VMGILVSYHI KVKLTVSGFL GELTSSEVAT EVPFRLMHPQ PEDPAKESVQ DENLVFEEFA RQNLKDTGEN TEGKKDEDAG QDE. It is sometimes possible for the material contained within the vial of "S-Arrestin (Sag), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.