Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human SAA1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 14 kDa.)

SAA1 recombinant protein

Recombinant Human SAA1 Protein

Gene Names
SAA1; SAA; PIG4; SAA2; TP53I4
Purity
>95% by SDS-PAGE.
Synonyms
SAA1; Recombinant Human SAA1 Protein; Serum Amyloid A-1 Protein; SAA; SAA1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM EDTA, pH 8.0.
Sequence
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
Sequence Length
122
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human SAA1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 14 kDa.)

SDS-Page (Recombinant Human SAA1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 14 kDa.)
Related Product Information for SAA1 recombinant protein
Description: Recombinant Human SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6xHis tag at the N-terminus.

Background: This protein is a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
Product Categories/Family for SAA1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Serum amyloid A-1 protein
NCBI Official Synonym Full Names
serum amyloid A1
NCBI Official Symbol
SAA1
NCBI Official Synonym Symbols
SAA; PIG4; SAA2; TP53I4
NCBI Protein Information
serum amyloid A-1 protein
UniProt Protein Name
Serum amyloid A-1 protein
Protein Family
UniProt Gene Name
SAA1
UniProt Synonym Gene Names
SAA
UniProt Entry Name
SAA1_HUMAN

NCBI Description

This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Feb 2016]

Uniprot Description

SAA1: Major acute phase reactant. Apolipoprotein of the HDL complex. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA1 protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Elevated serum SAA1 protein levels may be associated with lung cancer. Belongs to the SAA family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: extracellular region

Molecular Function: heparin binding; G-protein-coupled receptor binding

Biological Process: positive regulation of interleukin-1 secretion; receptor-mediated endocytosis; platelet activation; neutrophil chemotaxis; elevation of cytosolic calcium ion concentration; positive regulation of cell adhesion; regulation of protein secretion; negative regulation of inflammatory response; acute-phase response; innate immune response; lymphocyte chemotaxis; macrophage chemotaxis; positive regulation of cytokine secretion

Research Articles on SAA1

Similar Products

Product Notes

The SAA1 saa1 (Catalog #AAA9141910) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RSFFSFLGEA FDGARDMWRA YSDMREANYI GSDKYFHARG NYDAAKRGPG GVWAAEAISD ARENIQRFFG HGAEDSLADQ AADEWGRSGK DPNHFRPAGL PEKY. It is sometimes possible for the material contained within the vial of "SAA1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.