Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sphingosine 1-phosphate receptor 1 (S1pr1) Recombinant Protein | S1pr1 recombinant protein

Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1)

Gene Names
S1pr1; Edg1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sphingosine 1-phosphate receptor 1 (S1pr1); Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1); Recombinant Sphingosine 1-phosphate receptor 1 (S1pr1); Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1 Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1 CD_antigen= CD363; S1pr1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-383
Sequence
MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS
Sequence Length
383
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,746 Da
NCBI Official Full Name
sphingosine 1-phosphate receptor 1
NCBI Official Synonym Full Names
sphingosine-1-phosphate receptor 1
NCBI Official Symbol
S1pr1
NCBI Official Synonym Symbols
Edg1
NCBI Protein Information
sphingosine 1-phosphate receptor 1; S1P1; EDG1 (Edg1); S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation sphingolipid G-protein-coupled receptor 1
UniProt Protein Name
Sphingosine 1-phosphate receptor 1
UniProt Gene Name
S1pr1
UniProt Synonym Gene Names
Edg1; S1P receptor 1; S1P1
UniProt Entry Name
S1PR1_RAT

NCBI Description

G-protein-coupled receptor homolog; may mediate neurotransmission and endothelial cell differentiation [RGD, Feb 2006]

Uniprot Description

EDG-1: a G protein-coupled receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Highly expressed in endothelial cells and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin. Suggested to be involved in the processes that regulate the migration/differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. S1P-induced endothelial cell migration requires AKT1-mediated phosphorylation of the third intracellular loop. Seems to be coupled to the G(i) subclass of heteromeric G proteins.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR

Cellular Component: integral to membrane; intrinsic to plasma membrane; endosome; lipid raft; external side of plasma membrane

Molecular Function: G-protein coupled receptor activity; sphingolipid binding; G-protein-coupled receptor binding

Biological Process: lamellipodium biogenesis; regulation of cell adhesion; endothelial cell differentiation; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); cell migration; regulation of bone resorption; negative regulation of stress fiber formation; positive regulation of positive chemotaxis; positive regulation of smooth muscle cell proliferation; transmission of nerve impulse; chemotaxis; blood vessel maturation; neuron differentiation; G-protein coupled receptor protein signaling pathway; positive regulation of cell proliferation; actin cytoskeleton reorganization; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; G-protein signaling, adenylate cyclase inhibiting pathway; brain development; regulation of bone mineralization; positive regulation of cell migration; positive regulation of GTPase activity

Research Articles on S1pr1

Similar Products

Product Notes

The S1pr1 s1pr1 (Catalog #AAA949854) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-383. The amino acid sequence is listed below: MVSSTSIPVV KALRSQVSDY GNYDIIVRHY NYTGKLNIGV EKDHGIKLTS VVFILICCLI ILENIFVLLT IWKTKKFHRP MYYFIGNLAL SDLLAGVAYT ANLLLSGATT YKLTPAQWFL REGSMFVALS ASVFSLLAIA IERYITMLKM KLHNGSNSSR SFLLISACWV ISLILGGLPI MGWNCISSLS SCSTVLPLYH KHYILFCTTV FTLLLLSIVI LYCRIYSLVR TRSRRLTFRK NISKASRSSE KSLALLKTVI IVLSVFIACW APLFILLLLD VGCKAKTCDI LYKAEYFLVL AVLNSGTNPI IYTLTNKEMR RAFIRIISCC KCPNGDSAGK FKRPIIPGME FSRSKSDNSS HPQKDDGDNP ETIMSSGNVN SSS. It is sometimes possible for the material contained within the vial of "Sphingosine 1-phosphate receptor 1 (S1pr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.