Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Large envelope protein (S) Recombinant Protein | S recombinant protein

Recombinant Duck hepatitis B virus Large envelope protein (S)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Large envelope protein (S); Recombinant Duck hepatitis B virus Large envelope protein (S); Recombinant Large envelope protein (S); Large envelope protein; L glycoprotein L-HBsAg; LHB Large S protein Large surface protein Major surface antigen Cleaved into the following chain: 1. Truncated S protein; 2. St; S recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
164-240
Sequence
MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPHYVGSCPWGCPGFLWTYL
Sequence Length
330
Species
Duck hepatitis B virus (isolate brown Shanghai duck S5) (DHBV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
36,800 Da
NCBI Official Full Name
Large envelope protein
UniProt Protein Name
Large envelope protein
UniProt Gene Name
S
UniProt Synonym Gene Names
LHB; St
UniProt Entry Name
HBSAG_HPBDB

Uniprot Description

Function: The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. The large envelope protein probably also assumes fusion between virion and host membranes. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein

By similarity.Truncated S protein may be involved in translocation of pre-S domain through the virion membrane

By similarity.

Subunit structure: Large internal envelope protein interacts with capsid protein

By similarity.

Subcellular location: Virion membrane.

Domain: The large envelope protein is synthesized with the pre-S region at the cytosolic side of the endoplasmic reticulum and, hence will be within the virion after budding. Therefore the pre-S region is not N-glycosylated. Later a post-translational translocation of N-terminal pre-S and TM1 domains occur in about 50% of proteins at the virion surface. These molecules change their topology by an unknown mechanism, resulting in exposure of pre-S region at virion surface.

Post-translational modification: Myristoylation contributes importantly to DHBV infectivity. It is most likely required for an early step of the life cycle involving the entry or uncoating of virus particles.Phosphorylated on pre-S domain for about 50% of L proteins, the L chains with internal pre-S region (Li-HBsAg).

Sequence similarities: Belongs to the avihepadnavirus major surface antigen family.

Sequence caution: The sequence AAA45755.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The Large envelope protein (S) s (Catalog #AAA1111789) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 164-240. The amino acid sequence is listed below: MPGTFGGILA GLIGLLVSFF LLIKILEILR RLDWWWISLS SPKGKMQCAF QDTGAQISPH YVGSCPWGCP GFLWTYL. It is sometimes possible for the material contained within the vial of "Large envelope protein (S), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.