Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Ryanodine receptor 3 Recombinant Protein | RYR3 recombinant protein

Recombinant human Ryanodine receptor 3

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ryanodine receptor 3; Recombinant human Ryanodine receptor 3; RYR3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
3934-4181aa; Partial
Sequence
DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for RYR3 recombinant protein
Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis . Plays a role in cellular calcium signaling.1 Publication
Product Categories/Family for RYR3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32.5 kDa
NCBI Official Full Name
ryanodine receptor 3
NCBI Official Synonym Full Names
ryanodine receptor 3
NCBI Official Symbol
RYR3
NCBI Protein Information
ryanodine receptor 3; RYR-3; type 3 ryanodine receptor; brain-type ryanodine receptor; brain ryanodine receptor-calcium release channel
UniProt Protein Name
Ryanodine receptor 3
Protein Family
UniProt Gene Name
RYR3
UniProt Synonym Gene Names
HBRR; RYR-3; RyR3
UniProt Entry Name
RYR3_HUMAN

NCBI Description

The protein encoded by this gene is a ryanodine receptor, which functions to release calcium from intracellular storage for use in many cellular processes. For example, the encoded protein is involved in skeletal muscle contraction by releasing calcium from the sarcoplasmic reticulum followed by depolarization of T-tubules. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

RYR3: Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca(2+) release by other calcium channels. Calcium channel that mediates Ca(2+)-induced Ca(2+) release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis. Plays a role in cellular calcium signaling. Belongs to the ryanodine receptor (TC 1.A.3.1) family. RYR3 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ion channel; Transporter; Channel, calcium; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q14-q15

Cellular Component: sarcoplasmic reticulum membrane; perinuclear region of cytoplasm; junctional membrane complex; integral to membrane

Molecular Function: calmodulin binding; calcium-induced calcium release activity; calcium-release channel activity; calcium ion binding; ryanodine-sensitive calcium-release channel activity

Biological Process: striated muscle contraction; calcium ion transport; reduction of cytosolic calcium ion concentration; transmembrane transport; protein homotetramerization

Research Articles on RYR3

Similar Products

Product Notes

The RYR3 ryr3 (Catalog #AAA1265424) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3934-4181aa; Partial. The amino acid sequence is listed below: DGKGIISKKE FQKAMEGQKQ YTQSEIDFLL SCAEADENDM FNYVDFVDRF HEPAKDIGFN VAVLLTNLSE HMPNDSRLKC LLDPAESVLN YFEPYLGRIE IMGGAKKIER VYFEISESSR TQWEKPQVKE SKRQFIFDVV NEGGEQEKME LFVNFCEDTI FEMQLASQIS ESDSADRPEE EEEDEDSSYV LEIAGEEEED GSLEPASAFA MACASVKRNV TDFLKRATLK NLRKQYRNVK KMTAKELV. It is sometimes possible for the material contained within the vial of "Ryanodine receptor 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.