Probable ribosome biogenesis protein RLP24 (RSL24D1) Recombinant Protein | RSL24D1 recombinant protein
Recombinant Bovine Probable ribosome biogenesis protein RLP24 (RSL24D1)
Gene Names
RSL24D1; RLP24
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ribosome biogenesis protein RLP24 (RSL24D1); Recombinant Bovine Probable ribosome biogenesis protein RLP24 (RSL24D1); RSL24D1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-163, full length protein
Sequence
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDVKEVKQNIHLIRAPLAGKGKQLEDKMVQKLQEDVDMEDVS
Sequence Length
163
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RSL24D1 recombinant protein
This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,597 Da
NCBI Official Full Name
probable ribosome biogenesis protein RLP24
NCBI Official Synonym Full Names
ribosomal L24 domain containing 1
NCBI Official Symbol
RSL24D1
NCBI Official Synonym Symbols
RLP24
NCBI Protein Information
probable ribosome biogenesis protein RLP24
UniProt Protein Name
Probable ribosome biogenesis protein RLP24
UniProt Gene Name
RSL24D1
Uniprot Description
Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles ().
Similar Products
Product Notes
The RSL24D1 rsl24d1 (Catalog #AAA1408950) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-163, full length protein. The amino acid sequence is listed below: MRIEKCYFCS GPIYPGHGMM FVRNDCKVFR FCKSKCHKNF KKKRNPRKVR WTKAFRKAAG KELTVDNSFE FEKRRNEPVK YQRELWNKTI DAMKRVEEIK QKRQAKFIMN RLKKNKELQK VQDVKEVKQN IHLIRAPLAG KGKQLEDKMV QKLQEDVDME DVS. It is sometimes possible for the material contained within the vial of "Probable ribosome biogenesis protein RLP24 (RSL24D1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
