Probable lysozyme from lambdoid prophage DLP12 (arrD) Recombinant Protein | arrD recombinant protein
Recombinant Escherichia coli Probable lysozyme from lambdoid prophage DLP12 (arrD)
Gene Names
rrrD; arrD; ECK0546; JW0544; ybcS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable lysozyme from lambdoid prophage DLP12 (arrD); Recombinant Escherichia coli Probable lysozyme from lambdoid prophage DLP12 (arrD); arrD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-165, full length protein
Sequence
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
Sequence Length
165
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,972 Da
NCBI Official Full Name
DLP12 prophage; putative lysozyme
NCBI Official Symbol
rrrD
NCBI Official Synonym Symbols
arrD; ECK0546; JW0544; ybcS
NCBI Protein Information
DLP12 prophage; putative lysozyme
UniProt Protein Name
Lysozyme RrrD
Protein Family
UniProt Gene Name
rrrD
UniProt Synonym Gene Names
arrD; ybcS
NCBI Description
ArrD(YbcS) and ArrQ(YdfQ) are distant homologs of the phage lambda lysozyme R protein, as evidenced by all three matching to the pfam00959 profile (E values for pfam00959 hits using NCBI Conserved Domain (CD) Search: [More information is available at EcoGene: EG13635]. YbcS is an endolysin encoded by the cryptic lambdoid prophage DLP12 . [More information is available at EcoCyc: G6310].
Uniprot Description
Essential for lysis of bacterial cell wall, by showing cell wall hydrolyzing activity. Exhibits lytic activity against E.coli and S.typhi cell wall substrate.
Similar Products
Product Notes
The arrD rrrd (Catalog #AAA1084992) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-165, full length protein. The amino acid sequence is listed below: MPPSLRKAVA AAIGGGAIAI ASVLITGPSG NDGLEGVSYI PYKDIVGVWT VCHGHTGKDI MLGKTYTKAE CKALLNKDLA TVARQINPYI KVDIPETTRG ALYSFVYNVG AGNFRTSTLL RKINQGDIKG ACDQLRRWTY AGGKQWKGLM TRREIEREVC LWGQQ. It is sometimes possible for the material contained within the vial of "Probable lysozyme from lambdoid prophage DLP12 (arrD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
