Visual pigment-like receptor peropsin (Rrh) Recombinant Protein | Rrh recombinant protein
Recombinant Mouse Visual pigment-like receptor peropsin (Rrh)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Visual pigment-like receptor peropsin (Rrh); Recombinant Mouse Visual pigment-like receptor peropsin (Rrh); Recombinant Visual pigment-like receptor peropsin (Rrh); Visual pigment-like receptor peropsin; Rrh recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-337
Sequence
MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI
Sequence Length
337
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,209 Da
NCBI Official Full Name
visual pigment-like receptor peropsin
NCBI Official Synonym Full Names
retinal pigment epithelium derived rhodopsin homolog
NCBI Official Symbol
Rrh
NCBI Protein Information
visual pigment-like receptor peropsin
UniProt Protein Name
Visual pigment-like receptor peropsin
Protein Family
UniProt Gene Name
Rrh
UniProt Entry Name
OPSX_MOUSE
Uniprot Description
RRH: May play a role in rpe physiology either by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds. Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR
Cellular Component: membrane; integral to membrane
Molecular Function: G-protein coupled receptor activity; signal transducer activity; photoreceptor activity
Biological Process: G-protein coupled receptor protein signaling pathway; visual perception; response to stimulus; phototransduction; signal transduction; protein-chromophore linkage
Similar Products
Product Notes
The Rrh rrh (Catalog #AAA1203436) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-337. The amino acid sequence is listed below: MLSEASDFNS SGSRSEGSVF SRTEHSVIAA YLIVAGITSI LSNVVVLGIF IKYKELRTPT NAVIINLAFT DIGVSSIGYP MSAASDLHGS WKFGHAGCQI YAGLNIFFGM VSIGLLTVVA MDRYLTISCP DVGRRMTTNT YLSMILGAWI NGLFWALMPI IGWASYAPDP TGATCTINWR NNDTSFVSYT MMVIVVNFIV PLTVMFYCYY HVSRSLRLYA ASDCTAHLHR DWADQADVTK MSVIMILMFL LAWSPYSIVC LWACFGNPKK IPPSMAIIAP LFAKSSTFYN PCIYVAAHKK FRKAMLAMFK CQPHLAVPEP STLPMDMPQS SLAPVRI. It is sometimes possible for the material contained within the vial of "Visual pigment-like receptor peropsin (Rrh), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
