RNA pseudouridylate synthase domain-containing protein 3 (Rpusd3) Recombinant Protein | Rpusd3 recombinant protein
Recombinant Mouse RNA pseudouridylate synthase domain-containing protein 3 (Rpusd3)
Gene Names
Rpusd3; AI527266
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RNA pseudouridylate synthase domain-containing protein 3 (Rpusd3); Recombinant Mouse RNA pseudouridylate synthase domain-containing protein 3 (Rpusd3); Rpusd3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-344, full length protein
Sequence
MGALRVLRYVSMIWRPELGSCARQRDAGFGTEARRPSQPHRSSKHKDLVEDQPFPGLLRTENLGLEELAHVLRAAVVDQKGPLVTLNKPQGLPVTGRPGELTLLSVLPQLSQALGLEHQELQVVRAPGKEASGLVLLSSCPQTASRLQKFFIHSRRAQRPTATYCAVTDGIPEPSEGTVCMPLKMEQMNDVDLAVPVMSPSRKDIQEGVKRTLSRFHVMATGRGCALVQLQPLTVFPNQLQVHMALQLCPILGDHTYAARVGTVLGQRFLWPAETTKPQRQVLDEALLRHLRLSPSQVAQMPLHLHLHRLLLPGTGSRDPPSELLAPLPPYFSRTLQCLRLSQQ
Sequence Length
344
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,400 Da
NCBI Official Full Name
mitochondrial mRNA pseudouridine synthase Rpusd3 isoform 1
NCBI Official Synonym Full Names
RNA pseudouridylate synthase domain containing 3
NCBI Official Symbol
Rpusd3
NCBI Official Synonym Symbols
AI527266
NCBI Protein Information
mitochondrial mRNA pseudouridine synthase Rpusd3; RNA pseudouridylate synthase domain-containing protein 3
UniProt Protein Name
Mitochondrial mRNA pseudouridine synthase Rpusd3
Protein Family
UniProt Gene Name
Rpusd3
Uniprot Description
Major enzyme responsible for the conversion of uridine to pseudouridine (PSI) at position 390 in mitochondrial COXI (MT-CO1) mRNA and at position 697-699 in mitochondrial COXIII (MT-CO3) mRNA, modulating the efficiency of mitochondrial protein synthesis without changes in transcript abundance or stability.
Similar Products
Product Notes
The Rpusd3 rpusd3 (Catalog #AAA1480372) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-344, full length protein. The amino acid sequence is listed below: MGALRVLRYV SMIWRPELGS CARQRDAGFG TEARRPSQPH RSSKHKDLVE DQPFPGLLRT ENLGLEELAH VLRAAVVDQK GPLVTLNKPQ GLPVTGRPGE LTLLSVLPQL SQALGLEHQE LQVVRAPGKE ASGLVLLSSC PQTASRLQKF FIHSRRAQRP TATYCAVTDG IPEPSEGTVC MPLKMEQMND VDLAVPVMSP SRKDIQEGVK RTLSRFHVMA TGRGCALVQL QPLTVFPNQL QVHMALQLCP ILGDHTYAAR VGTVLGQRFL WPAETTKPQR QVLDEALLRH LRLSPSQVAQ MPLHLHLHRL LLPGTGSRDP PSELLAPLPP YFSRTLQCLR LSQQ. It is sometimes possible for the material contained within the vial of "RNA pseudouridylate synthase domain-containing protein 3 (Rpusd3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
