SDS-PAGE
Active regulator of SIRT1 Recombinant Protein | AROS recombinant protein
Recombinant Human Active regulator of SIRT1 protein
Gene Names
RPS19BP1; AROS; S19BP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Active regulator of SIRT1; Recombinant Human Active regulator of SIRT1 protein; AROS recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-145aa; Full Length
Sequence
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Sequence Length
136
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for AROS recombinant protein
Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.
Product Categories/Family for AROS recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42.4 kDa
NCBI Official Full Name
active regulator of SIRT1
NCBI Official Synonym Full Names
ribosomal protein S19 binding protein 1
NCBI Official Symbol
RPS19BP1
NCBI Official Synonym Symbols
AROS; S19BP
NCBI Protein Information
active regulator of SIRT1
UniProt Protein Name
Active regulator of SIRT1
Protein Family
UniProt Gene Name
RPS19BP1
UniProt Synonym Gene Names
AROS; RPS19-binding protein 1; S19BP
UniProt Entry Name
AROS_HUMAN
Uniprot Description
Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.
Research Articles on AROS
Similar Products
Product Notes
The AROS rps19bp1 (Catalog #AAA717059) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-145aa; Full Length. The amino acid sequence is listed below: MSAALLRRGL ELLAASEAPR DPPGQAKPRG APVKRPRKTK AIQAQKLRNS AKGKVPKSAL DEYRKRECRD HLRVNLKFLT RTRSTVAESV SQQILRQNRG RKACDRPVAK TKKKKAEGTV FTEEDFQKFQ QEYFGS. It is sometimes possible for the material contained within the vial of "Active regulator of SIRT1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
