Protein XRP2 (RP2) Recombinant Protein | RP2 recombinant protein

Recombinant Human Protein XRP2 (RP2)

Cat. Num. AAA1238040

• Gene Names: RP2; XRP2; NME10; TBCCD2; NM23-H10; DELXp11.3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein XRP2 (RP2); Recombinant Human Protein XRP2 (RP2); Protein XRP2; RP2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-350aa; Full Length
• Sequence: GCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
• Sequence Length: 349

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for RP2 recombinant protein

Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins.

Product Categories/Family for RP2 recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 170016081
• NCBI GeneID: 6102
• NCBI Accession #: NP_008846.2
• NCBI GenBank Nucleotide #: NM_006915.2
• UniProt Accession #: O75695; Q86XJ7; Q9NU67
• Molecular Weight: 66.5 kDa
• NCBI Official Full Name: protein XRP2
• NCBI Official Synonym Full Names: retinitis pigmentosa 2 (X-linked recessive)
• NCBI Official Symbol: RP2
• NCBI Official Synonym Symbols: XRP2; NME10; TBCCD2; NM23-H10; DELXp11.3
• NCBI Protein Information: protein XRP2
• UniProt Protein Name: Protein XRP2
• Protein Family: Protein
• UniProt Gene Name: RP2
• UniProt Entry Name: XRP2_HUMAN

NCBI Description

The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death [provided by RefSeq, Jul 2008]

Uniprot Description

RP2: Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins. Defects in RP2 are the cause of retinitis pigmentosa type 2 (RP2); also known as X-linked retinitis pigmentosa 2 (XLRP-2). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Belongs to the TBCC family.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: Xp11.3

Cellular Component: centriole; Golgi apparatus; cytoplasm; plasma membrane; cytoplasmic vesicle

Molecular Function: protein binding; GTP binding; unfolded protein binding; nucleoside diphosphate kinase activity; actin binding; ATP binding; GTPase activator activity

Biological Process: GTP biosynthetic process; protein folding; UTP biosynthetic process; organelle organization and biogenesis; cell morphogenesis; nucleoside diphosphate phosphorylation; cytoskeleton organization and biogenesis; CTP biosynthetic process; protein transport; visual perception; post-Golgi vesicle-mediated transport; post-chaperonin tubulin folding pathway; positive regulation of GTPase activity

Disease: Retinitis Pigmentosa 2