Rod outer segment membrane protein 1 (ROM1) Recombinant Protein | ROM1 recombinant protein
Recombinant Bovine Rod outer segment membrane protein 1 (ROM1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rod outer segment membrane protein 1 (ROM1); Recombinant Bovine Rod outer segment membrane protein 1 (ROM1); Recombinant Rod outer segment membrane protein 1 (ROM1); Rod outer segment membrane protein 1; ROSP1; ROM1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351aa; Full Length
Sequence
MAPVLPLVLPLQPRIRLAQGLWLLSWLLVLVGGLTLLCSGHLLVQLWHLGTFLAPSCPFSALPQVALAASAVALGTGLVGSGASRASLDAEQYPPWRGVLGPLLVAGTAGGGGLLVLALGLALALPGTLDTGLEEGLGSALVHYKDTEVPGRCQAKRLLDELQLRHHCCGRHGYKDWFGIQWVSNRYLDPNDPDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPHAHPLFDPRQPNLNLWSQGCHEVLLGHLQGLASTLGNMLAVTFLLQTLVLLGLRYLQTALEGLGGVIDGEGEAQGYLFPAGLKDMLKTAWLQGAGPHRPAPGETPPEEKPPKECLPEA
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,418 Da
NCBI Official Full Name
rod outer segment membrane protein 1
NCBI Official Synonym Full Names
retinal outer segment membrane protein 1<
NCBI Official Symbol
ROM1
NCBI Protein Information
rod outer segment membrane protein 1; ROSP1
UniProt Protein Name
Rod outer segment membrane protein 1
Protein Family
UniProt Gene Name
ROM1
UniProt Synonym Gene Names
ROSP1
UniProt Entry Name
ROM1_BOVIN
Uniprot Description
Function: May function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. It is essential for disk morphogenesis
By similarity.
Subunit structure: Homodimer; disulfide-linked. Probably forms a complex with a PRPH2 homodimer. Other proteins could associate with this complex in rods
By similarity.
Subcellular location: Membrane; Multi-pass membrane protein.
Tissue specificity: Retina (photoreceptor). In rim region of ROS (rod outer segment) disks.
Involvement in disease: Note=May be involved in mammalian retinopathies.
Sequence similarities: Belongs to the PRPH2/ROM1 family.
Similar Products
Product Notes
The ROM1 rom1 (Catalog #AAA968235) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351aa; Full Length. The amino acid sequence is listed below: MAPVLPLVLP LQPRIRLAQG LWLLSWLLVL VGGLTLLCSG HLLVQLWHLG TFLAPSCPFS ALPQVALAAS AVALGTGLVG SGASRASLDA EQYPPWRGVL GPLLVAGTAG GGGLLVLALG LALALPGTLD TGLEEGLGSA LVHYKDTEVP GRCQAKRLLD ELQLRHHCCG RHGYKDWFGI QWVSNRYLDP NDPDVVDRIQ SNVEGLYLID GVPFSCCNPH SPRPCLQSQL SDPHAHPLFD PRQPNLNLWS QGCHEVLLGH LQGLASTLGN MLAVTFLLQT LVLLGLRYLQ TALEGLGGVI DGEGEAQGYL FPAGLKDMLK TAWLQGAGPH RPAPGETPPE EKPPKECLPE A . It is sometimes possible for the material contained within the vial of "Rod outer segment membrane protein 1 (ROM1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
