Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable E3 ubiquitin-protein ligase RNF217 (RNF217) Recombinant Protein | RNF217 recombinant protein

Recombinant Human Probable E3 ubiquitin-protein ligase RNF217 (RNF217)

Gene Names
RNF217; OSTL; IBRDC1; C6orf172; dJ84N20.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable E3 ubiquitin-protein ligase RNF217 (RNF217); Recombinant Human Probable E3 ubiquitin-protein ligase RNF217 (RNF217); RNF217 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-275aa; full length protein
Sequence
MKVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHF TTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASE IEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIF GCKYRYLPERPHLRRLVRGSVCAGKLFIAPLIMVLGLALGAIAVVIVEEIKTYWNLISGR TRNQTQHLAPQPVLLSDMLYCLKQVFICISYLLPL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RNF217 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,981 Da
NCBI Official Full Name
probable E3 ubiquitin-protein ligase RNF217 isoform a
NCBI Official Synonym Full Names
ring finger protein 217
NCBI Official Symbol
RNF217
NCBI Official Synonym Symbols
OSTL; IBRDC1; C6orf172; dJ84N20.1
NCBI Protein Information
probable E3 ubiquitin-protein ligase RNF217
UniProt Protein Name
Probable E3 ubiquitin-protein ligase RNF217
UniProt Gene Name
RNF217
UniProt Synonym Gene Names
C6orf172; IBRDC1
UniProt Entry Name
RN217_HUMAN

NCBI Description

This protein encoded by this gene is a member of the RING1-IBR-RING24 (RBR) ubiquitin protein ligase family, and it belongs to a subfamily of these proteins that contain a transmembrane domain. This protein can interact with the HAX1 anti-apoptotic protein via its C-terminal RING finger motif, which suggests a role in apoptosis signaling. It is thought that deregulation of this gene can be a mechanism in leukemogenesis. Mutations in the region encoding the protein GXXXG motif, which appears to be necessary for protein self-association, have been found in human cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2016]

Uniprot Description

RNF217: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RBR family. RNF217 subfamily.

Protein type: EC 6.3.2.19; Ubiquitin ligase; Ligase; Ubiquitin conjugating system; Membrane protein, integral; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 6q22.31

Cellular Component: cytoplasm; cytosol; integral to membrane; ubiquitin ligase complex

Molecular Function: ligase activity; metal ion binding; ubiquitin conjugating enzyme binding; ubiquitin-protein ligase activity

Biological Process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process

Research Articles on RNF217

Similar Products

Product Notes

The RNF217 rnf217 (Catalog #AAA7028781) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-275aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RNF217 rnf217 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKVQLGQVEI KCPITECFEF LEETTVVYNL THEDSIKYKY FLELGRIDSS TKPCPQCKHF TTFKKKGHIP TPSRSESKYK IQCPTCQFVW CFKCHSPWHE GVNCKEYKKG DKLLRHWASE IEHGQRNAQK CPKCKIHIQR TEGCDHMTCS QCNTNFCYRC GERYRQLRFF GDHTSNLSIF GCKYRYLPER PHLRRLVRGS VCAGKLFIAP LIMVLGLALG AIAVVIVEEI KTYWNLISGR TRNQTQHLAP QPVLLSDMLY CLKQVFICIS YLLPL. It is sometimes possible for the material contained within the vial of "Probable E3 ubiquitin-protein ligase RNF217 (RNF217), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.