Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RNF19B (Rnf19b) Recombinant Protein | Rnf19b recombinant protein

Recombinant Mouse E3 ubiquitin-protein ligase RNF19B (Rnf19b)

Gene Names
Rnf19b; Ibrdc3; 4930534K13Rik; 4930555L03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF19B (Rnf19b); Recombinant Mouse E3 ubiquitin-protein ligase RNF19B (Rnf19b); Rnf19b recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-732aa; Full length protein
Sequence
MGSEKDSESPRSTSLHAAAPDPKCRSGGRRRRLTFHSVFSASARGRRARTKPQAEPPPPA APPPPPPPAPAPVEAQAPPVEALPSEPAAEAEAEAVAAGPEEDEAAEGGGAEEVECPLCL VRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPP LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQ IWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCN HMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISL IAGIAIPAMVIGIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGI GVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGE SSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQA DVQKEIFPKDTASLGAISDSASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHYQLV SGSSTEDSLHVHAQVAEKEEEGNGAGGGSGGSEDDPPYKHQSCEQKDCLASKAWDISLAQ PESIRSDLESSDTQSDDVPDITSDECGSPRSHAAACPSTPQVHGAPSPSAHKNLAAPAEG QTVLKSEEYEVE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rnf19b recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,127 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF19B isoform X2
NCBI Official Synonym Full Names
ring finger protein 19B
NCBI Official Symbol
Rnf19b
NCBI Official Synonym Symbols
Ibrdc3; 4930534K13Rik; 4930555L03Rik
NCBI Protein Information
E3 ubiquitin-protein ligase RNF19B
UniProt Protein Name
E3 ubiquitin-protein ligase RNF19B
UniProt Gene Name
Rnf19b
UniProt Synonym Gene Names
Ibrdc3; Nklam
UniProt Entry Name
RN19B_MOUSE

Uniprot Description

RNF19B: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as UCKL1. Involved in the cytolytic activity of natural killer cells and cytotoxic T-cells. Belongs to the RBR family. RNF19 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ubiquitin conjugating system; Membrane protein, multi-pass; EC 6.3.2.19; Membrane protein, integral; Ligase; EC 6.3.2.-

Cellular Component: cytoplasm; integral to membrane; membrane; ubiquitin ligase complex

Molecular Function: coenzyme F420-0 gamma-glutamyl ligase activity; coenzyme F420-2 alpha-glutamyl ligase activity; ligase activity; metal ion binding; ribosomal S6-glutamic acid ligase activity; ubiquitin conjugating enzyme binding; ubiquitin-protein ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; zinc ion binding

Biological Process: adaptive immune response; immune system process; natural killer cell mediated cytotoxicity; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process

Research Articles on Rnf19b

Similar Products

Product Notes

The Rnf19b rnf19b (Catalog #AAA7028779) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-732aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rnf19b rnf19b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSEKDSESP RSTSLHAAAP DPKCRSGGRR RRLTFHSVFS ASARGRRART KPQAEPPPPA APPPPPPPAP APVEAQAPPV EALPSEPAAE AEAEAVAAGP EEDEAAEGGG AEEVECPLCL VRLPPERAPR LLSCPHRSCR DCLRHYLRLE ISESRVPISC PECSERLNPH DIRLLLADPP LMHKYEEFML RRYLASDPDC RWCPAPDCGY AVIAYGCASC PKLTCEREGC QTEFCYHCKQ IWHPNQTCDM ARQQRAQTLR VRTKHTSGLS YGQESGPADD IKPCPRCSAY IIKMNDGSCN HMTCAVCGCE FCWLCMKEIS DLHYLSPSGC TFWGKKPWSR KKKILWQLGT LIGAPVGISL IAGIAIPAMV IGIPVYVGRK IHSRYEGRKT SKHKRNLAIT GGVTLSVIAS PVIAAVSVGI GVPIMLAYVY GVVPISLCRG GGCGVSTANG KGVKIEFDED DGPITVADAW RALKNPSIGE SSIEGLTSVL STSGSPTDGL SVMQGPYSET ASFAALSGGT LSGGILSSGK GKYSRLEVQA DVQKEIFPKD TASLGAISDS ASTRAMAGSI ISSYNPQDRE CNNMEIQVDI EAKPSHYQLV SGSSTEDSLH VHAQVAEKEE EGNGAGGGSG GSEDDPPYKH QSCEQKDCLA SKAWDISLAQ PESIRSDLES SDTQSDDVPD ITSDECGSPR SHAAACPSTP QVHGAPSPSA HKNLAAPAEG QTVLKSEEYE VE. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF19B (Rnf19b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.