Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RNF144B (RNF144B) Recombinant Protein | RNF144B recombinant protein

Recombinant Bovine E3 ubiquitin-protein ligase RNF144B (RNF144B)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF144B (RNF144B); Recombinant Bovine E3 ubiquitin-protein ligase RNF144B (RNF144B); Recombinant E3 ubiquitin-protein ligase RNF144B (RNF144B); E3 ubiquitin-protein ligase RNF144B EC= 6.3.2.-; RING finger protein 144B; RNF144B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-304
Sequence
MGSVGRLHCLTMTAAENPTPGDLALVPLVTCKLCLCEQSLDKMTTLQECRCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPCRTWCPVADCQTVCPVATSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPGILPTEHGTLFGTETDAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDRGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT
Sequence Length
304
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,725 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF144B
NCBI Official Synonym Full Names
ring finger protein 144B<
NCBI Official Symbol
RNF144B
NCBI Protein Information
E3 ubiquitin-protein ligase RNF144B; ring finger 144B
UniProt Protein Name
E3 ubiquitin-protein ligase RNF144B
UniProt Gene Name
RNF144B
UniProt Entry Name
R144B_BOVIN

Uniprot Description

Function: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se

By similarity.

Pathway: Protein modification; protein ubiquitination.

Subunit structure: Interacts with UBE2L3, UBE2L6 and LCMT2 as well as with BAX

By similarity.

Subcellular location: Mitochondrion membrane; Single-pass membrane protein. Cytoplasm. Note: Mostly cytosololic, accumulates in submitochondrial domains specifically upon apoptosis induction, in synchrony with BAX activation

By similarity.

Domain: The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme. The transmembrane domain is essential for translocation to the mitochondria upon induction of apoptosis

By similarity.

Post-translational modification: Auto-ubiquitinated

By similarity.

Sequence similarities: Belongs to the RBR family. RNF144 subfamily.Contains 1 IBR-type zinc finger.Contains 2 RING-type zinc fingers.

Caution: Lacks the His residue in the RING-type domain 2 that is one of the conserved features of the family.

Similar Products

Product Notes

The RNF144B rnf144b (Catalog #AAA1178756) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-304. The amino acid sequence is listed below: MGSVGRLHCL TMTAAENPTP GDLALVPLVT CKLCLCEQSL DKMTTLQECR CIFCTACLKQ YMQLAIREGC GSPITCPDMV CLNHGTLQEA EIACLVPVDQ FQLYQRLKFE REVHLDPCRT WCPVADCQTV CPVATSDPGQ PVLVECPSCH LKFCSCCKDA WHAEVSCRDS QPGILPTEHG TLFGTETDAP IKQCPVCRVY IERNEGCAQM MCKNCKHTFC WYCLQNLDND IFLRHYDRGP CRNKLGHSRA SVMWNRTQVV GILVGLGIIA LVTSPLLLLA SPCIICCVCK SCRGKKKKHD PSTT. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF144B (RNF144B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.