Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RNF144B (RNF144B) Recombinant Protein | RNF144B recombinant protein

Recombinant Human E3 ubiquitin-protein ligase RNF144B (RNF144B)

Gene Names
RNF144B; PIR2; IBRDC2; p53RFP; bA528A10.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF144B (RNF144B); Recombinant Human E3 ubiquitin-protein ligase RNF144B (RNF144B); RNF144B recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-303aa; full length protein
Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQY MQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTW CPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRA LFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPC RNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDP STT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RNF144B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,856 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF144B
NCBI Official Synonym Full Names
ring finger protein 144B
NCBI Official Symbol
RNF144B
NCBI Official Synonym Symbols
PIR2; IBRDC2; p53RFP; bA528A10.3
NCBI Protein Information
E3 ubiquitin-protein ligase RNF144B
UniProt Protein Name
E3 ubiquitin-protein ligase RNF144B
UniProt Gene Name
RNF144B
UniProt Synonym Gene Names
IBRDC2; P53RFP
UniProt Entry Name
R144B_HUMAN

Uniprot Description

RNF144B: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se. Belongs to the RBR family. RNF144 subfamily.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Membrane protein, integral; Ligase; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: cytoplasm; cytosol; integral to membrane; mitochondrial membrane; ubiquitin ligase complex

Molecular Function: ligase activity; protein binding; ubiquitin conjugating enzyme binding; ubiquitin-protein ligase activity; zinc ion binding

Biological Process: apoptosis; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process

Research Articles on RNF144B

Similar Products

Product Notes

The RNF144B rnf144b (Catalog #AAA7028735) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-303aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RNF144B rnf144b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSAGRLHYL AMTAENPTPG DLAPAPLITC KLCLCEQSLD KMTTLQECQC IFCTACLKQY MQLAIREGCG SPITCPDMVC LNHGTLQEAE IACLVPVDQF QLYQRLKFER EVHLDPYRTW CPVADCQTVC PVASSDPGQP VLVECPSCHL KFCSCCKDAW HAEVSCRDSQ PIVLPTEHRA LFGTDAEAPI KQCPVCRVYI ERNEGCAQMM CKNCKHTFCW YCLQNLDNDI FLRHYDKGPC RNKLGHSRAS VMWNRTQVVG ILVGLGIIAL VTSPLLLLAS PCIICCVCKS CRGKKKKHDP STT. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF144B (RNF144B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.