Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable E3 ubiquitin-protein ligase RNF144A (RNF144A) Recombinant Protein | RNF144A recombinant protein

Recombinant Human Probable E3 ubiquitin-protein ligase RNF144A (RNF144A)

Gene Names
RNF144A; RNF144; UBCE7IP4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable E3 ubiquitin-protein ligase RNF144A (RNF144A); Recombinant Human Probable E3 ubiquitin-protein ligase RNF144A (RNF144A); Recombinant Probable E3 ubiquitin-protein ligase RNF144A (RNF144A); Probable E3 ubiquitin-protein ligase RNF144A EC= 6.3.2.-; RING finger protein 144A UbcM4-interacting protein 4 Ubiquitin-conjugating enzyme 7-interacting protein 4; RNF144A recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-292
Sequence
MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Sequence Length
292
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,890 Da
NCBI Official Full Name
probable E3 ubiquitin-protein ligase RNF144A
NCBI Official Synonym Full Names
ring finger protein 144A
NCBI Official Symbol
RNF144A
NCBI Official Synonym Symbols
RNF144; UBCE7IP4
NCBI Protein Information
probable E3 ubiquitin-protein ligase RNF144A; UbcM4-interacting protein 4; ubiquitin conjugating enzyme 7 interacting protein 4; ubiquitin-conjugating enzyme 7-interacting protein 4
UniProt Protein Name
Probable E3 ubiquitin-protein ligase RNF144A
UniProt Gene Name
RNF144A
UniProt Synonym Gene Names
KIAA0161; RNF144; UBCE7IP4
UniProt Entry Name
R144A_HUMAN

NCBI Description

The protein encoded by this protein contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. The mouse counterpart of this protein has been shown to interact with Ube2l3/UbcM4, which is an ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Jul 2008]

Uniprot Description

RNF144A: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RBR family. RNF144 subfamily.

Protein type: EC 6.3.2.-; Membrane protein, integral; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 2p25.2

Cellular Component: Golgi apparatus; cytoplasmic vesicle membrane; integral to membrane; plasma membrane

Molecular Function: zinc ion binding; ligase activity

Biological Process: protein ubiquitination

Research Articles on RNF144A

Similar Products

Product Notes

The RNF144A rnf144a (Catalog #AAA955447) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-292. The amino acid sequence is listed below: MTTTRYRPTW DLALDPLVSC KLCLGEYPVE QMTTIAQCQC IFCTLCLKQY VELLIKEGLE TAISCPDAAC PKQGHLQENE IECMVAAEIM QRYKKLQFER EVLFDPCRTW CPASTCQAVC QLQDVGLQTP QPVQCKACRM EFCSTCKASW HPGQGCPETM PITFLPGETS AAFKMEEDDA PIKRCPKCKV YIERDEGCAQ MMCKNCKHAF CWYCLESLDD DFLLIHYDKG PCRNKLGHSR ASVIWHRTQV VGIFAGFGLL LLVASPFLLL ATPFVLCCKC KCSKGDDDPL PT. It is sometimes possible for the material contained within the vial of "Probable E3 ubiquitin-protein ligase RNF144A (RNF144A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.