E3 ubiquitin-protein ligase RNF14 (Rnf14) Recombinant Protein | Rnf14 recombinant protein
Recombinant Mouse E3 ubiquitin-protein ligase RNF14 (Rnf14)
Gene Names
Rnf14; Triad2; AA986456; AU041447; D7Bwg0165e; D18Ertd188e; 2310075C09Rik; 2610005D23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF14 (Rnf14); Recombinant Mouse E3 ubiquitin-protein ligase RNF14 (Rnf14); Rnf14 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-485, full length protein
Sequence
MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD
Sequence Length
485
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rnf14 recombinant protein
This protein contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
8,631 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF14 isoform a
NCBI Official Synonym Full Names
ring finger protein 14
NCBI Official Symbol
Rnf14
NCBI Official Synonym Symbols
Triad2; AA986456; AU041447; D7Bwg0165e; D18Ertd188e; 2310075C09Rik; 2610005D23Rik
NCBI Protein Information
E3 ubiquitin-protein ligase RNF14
UniProt Protein Name
E3 ubiquitin-protein ligase RNF14
Protein Family
UniProt Gene Name
Rnf14
UniProt Synonym Gene Names
Ara54; Triad2
Uniprot Description
Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription ().
Research Articles on Rnf14
Similar Products
Product Notes
The Rnf14 rnf14 (Catalog #AAA1455837) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-485, full length protein. The amino acid sequence is listed below: MSAEDLEAQE DELLALASIY DADEFRKAES VQGGETRIYL DLPQNFKIFV SGNSNESLQN SGFEYTICFL PPLVLNFELP PDYPSSSPPS FTLSGKWLSP TQLSALCKHL DNLWEEHRGR VVLFAWMQFL KEETLTYLNI VSPFELKMGS QKKVQRRATA QASSSTELGV GGAAAADVDQ EETVDERAVQ DVESLSSLIQ EILDFNQARQ TKCFNSKLFL CSICFCEKLG SDCMYFLECK HVYCKACLKD YFEIQIKDGQ VKCLNCPEPQ CPSVATPGQV KELVEADLFA RYDRLLLQST LDLMADVVYC PRPCCQLPVM QEPGGTMAIC SSCNFAFCTL CRLTYHGLSP CKVTAEKLID LRNEYLQADE ATKRFLEQRY GKRVIQKALE EMESKDWLEK NSKSCPCCGT PIQKLDGCNK MTCTGCMQYF CWICMGSLSR ANPYRHFTDS ESPCFNRLFH AVDINGDMWE DEIEEDDDDE DDDDD. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF14 (Rnf14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
